Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75447 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Moesin antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bacterial growth. This bactericidal activity is achieved by binding to DNA-dependent RNA polymerase, hindering transcription and replication processes.GSDML antibody
GSDML antibody was raised using the N terminal of GSDML corresponding to a region with amino acids HLVGEKRTFFGCRHYTTGLTLMDILDTDGDKWLDELDSGLQGQKAEFQILH2AFY antibody
H2AFY antibody was raised using the N terminal of H2AFY corresponding to a region with amino acids MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAGamma catenin antibody
The Gamma catenin antibody is a highly specialized monoclonal antibody used in Life Sciences research. This antibody specifically targets and neutralizes the activity of gamma catenin, a protein involved in cell adhesion and signaling pathways. It has been shown to inhibit the activation of growth factors and prevent the formation of disulfide bonds in collagen and fibronectin. The Gamma catenin antibody is widely used in immunoassays to detect and quantify gamma catenin levels in various samples. Its high affinity for the target protein ensures accurate and reliable results. Additionally, this antibody has excellent pharmacokinetic properties, making it suitable for therapeutic applications.ELK1 antibody
The ELK1 antibody is a highly specific polyclonal antibody that targets the subtilisin/kexin type of enzymes. It is capable of recognizing and binding to the activated form of ELK1, a transcription factor involved in hepatocyte growth. This monoclonal antibody has been extensively used in various life sciences research applications, particularly in the study of mesenchymal stem cells.
EPHA1 antibody
EPHA1 antibody was raised in Mouse using a purified recombinant fragment of EPHA1 expressed in E. coli as the immunogen.CK18 antibody
The CK18 antibody is a monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to CK18 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be highly effective in inhibiting the activity of CK18.HNRNPF antibody
HNRNPF antibody was raised in Rabbit using recombinant human HNRNPF (2-154AA) as the immunogenCD40L antibody
The CD40L antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically bind to CD40L, an important protein involved in immune responses. This antibody has been extensively studied and proven to be effective in various applications, including antiestrogen therapy.EIF3S9 antibody
EIF3S9 antibody was raised using the C terminal of EIF3S9 corresponding to a region with amino acids YRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIP
