Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,709 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(738 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75327 products of "Primary Antibodies"
TBLR1 antibody
The TBLR1 antibody is a highly specialized product that plays a crucial role in the field of Life Sciences. It acts as a growth factor and has been extensively studied for its potential therapeutic applications. This antibody specifically targets caspase-9, an enzyme involved in programmed cell death.
Human IgG Antibody
The Human IgG Antibody is a monoclonal antibody that plays a crucial role in various biological processes. It is widely used in Life Sciences research and immunoassays. This specific antibody targets various proteins, including growth factors, creatine, TGF-beta, epidermal growth factor, and the plasminogen receptor. By binding to these proteins, the Human IgG Antibody can modulate their activity and regulate important cellular functions.Kallikrein antibody
Kallikrein antibody is a powerful tool used in life sciences research. It targets kallikrein, an enzyme involved in various physiological processes such as blood pressure regulation, inflammation, and tissue remodeling. This antibody can inhibit the activity of kallikrein by binding to its active site, thus preventing its interaction with substrates.
EIF2B1 antibody
EIF2B1 antibody was raised using the C terminal of EIF2B1 corresponding to a region with amino acids ADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKL
