Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,609 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(746 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,394 products)
- Metabolism Antibodies(278 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,710 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75081 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
SIAH1 antibody
<p>The SIAH1 antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and binds to the SIAH1 protein, which plays a crucial role in various cellular processes. This polyclonal antibody can be used in experiments such as Western blotting, immunohistochemistry, and ELISA to detect and quantify the expression of SIAH1.</p>NCOR2 antibody
<p>The NCOR2 antibody is a highly specialized product used in Life Sciences research. It is a monoclonal antibody that specifically targets the NCOR2 protein, which plays a crucial role in various cellular processes. This antibody has been extensively tested and validated for its specificity and effectiveness.</p>PIM1 antibody
<p>The PIM1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets insulin and is commonly used to study insulin-related processes and functions. The antibody is produced using recombinant antigen technology, ensuring high specificity and sensitivity. It recognizes histidine residues on the insulin molecule, allowing for precise detection and analysis. The PIM1 antibody has been extensively tested and validated for its neutralizing and cytotoxic properties against insulin and related growth factors. It can be used in various applications, including immunohistochemistry, Western blotting, ELISA, and flow cytometry. Researchers rely on the PIM1 antibody to gain insights into insulin signaling pathways, autoantibodies against insulin in human serum, epidermal growth factor interactions, and other important biological processes involving insulins and growth factors.</p>SOX10 antibody
<p>The SOX10 antibody is a growth factor that plays a crucial role in various biological processes. It interacts with fibronectin and calpain, and its activity can be modulated by substances such as taxol. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in different research areas.</p>Goat anti Rabbit IgG (H + L) (biotin)
<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>Purity:Min. 95%Alirocumab
CAS:<p>Monoclonal antibody to PCSK9 ; inhibitor of proprotein convertase PCSK9</p>Purity:Min. 95%Color and Shape:LiquidC2orf25 antibody
<p>C2orf25 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSSGSDESHVAAAPPDICSRTVWPDETMGPFGPQDQRFQLPGNIGFDCHL</p>CD45.2 antibody (PE-CY5.5)
<p>CD45.2 antibody (PE-CY5.5) was raised in mouse using CD45.2 as the immunogen.</p>Purity:Min. 95%Molecular weight:0 g/mol
