Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,609 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(746 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,394 products)
- Metabolism Antibodies(278 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,710 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75081 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
CD24 antibody (Azide Free)
<p>CD24 antibody (Azide Free) was raised in rat using murine heat stable antigen as the immunogen.</p>TRANCE antibody
<p>The TRANCE antibody is an inhibiting antibody that targets pluripotent stem cells. It acts as an inhibitor by binding to specific receptors on the surface of these stem cells, preventing their growth and differentiation. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>UBA5 antibody
<p>The UBA5 antibody is a highly specialized protein kinase and phosphatase that plays a crucial role in various Life Sciences applications. It is widely used in research laboratories for its ability to detect and quantify specific proteins and biomolecules. This antibody has been extensively studied and proven to be effective in detecting targets such as alpha-fetoprotein, genotoxic inhibitors, anti-beta amyloid antibodies, chemokines, and growth factors.</p>RPS6 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. Specifically designed to combat tuberculosis infection, this active compound exhibits bactericidal activity by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase. This prevents transcription and replication, effectively halting the spread of the disease. Additionally, it has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Metabolized through various pathways including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, this drug delivers targeted treatment against Mycobacterium tuberculosis strains. With its multifaceted mechanism of action and proven efficacy, 6-Fluoro-3-indoxyl-beta-D-galactopyranos</p>USP48 antibody
<p>USP48 antibody was raised using the middle region of USP48 corresponding to a region with amino acids ALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYV</p>Keratin K13 antibody
<p>Keratin K13 antibody was raised in mouse using Keratin K13 purified from human esophagus as the immunogen.</p>MAGE antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug that falls under the class of rifamycins. This active compound is highly effective in treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. Its bactericidal activity has been confirmed through extensive research using techniques like patch-clamp and transcription-quantitative polymerase chain. Metabolically, this drug undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth. Experience the powerful action of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for effective treatment against tuberculosis.</p>
