Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,609 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(746 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,394 products)
- Metabolism Antibodies(278 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,710 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75081 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Focal Adhesion Kinase antibody
<p>The Focal Adhesion Kinase antibody is a growth factor monoclonal antibody that specifically targets focal adhesion kinase (FAK). FAK is a protein that plays a crucial role in cell adhesion and migration. This antibody binds to FAK, preventing its activation and inhibiting downstream signaling pathways involved in cell proliferation and survival.</p>Goat RBC antibody (Texas Red)
<p>Goat RBC antibody (Texas Red) was raised in rabbit using goat erythrocytes as the immunogen.</p>RUFY1 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection and has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. This active compound exhibits oxidative metabolites and undergoes hydrolysis by esterases, reduction by glutathione reductase, and oxidation by cytochrome p450 enzymes. It specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>SLC25A15 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, which prevents transcription and replication. The effectiveness of this drug has been demonstrated through patch-clamp technique studies on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>AFP antibody
<p>The AFP antibody is a highly specialized monoclonal antibody that has been developed for various applications in the field of biomedical research. This antibody specifically targets and binds to alpha-fetoprotein (AFP), a human protein that is commonly found in the serum of individuals with certain medical conditions.</p>SENP2 antibody
<p>SENP2 antibody was raised using the middle region of SENP2 corresponding to a region with amino acids RICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQLNGSDCGMFT</p>E2F5 antibody
<p>E2F5 antibody was raised in mouse using recombinant Human Transcription Factor E2F-5</p>SH3RF1 antibody
<p>SH3RF1 antibody was raised using the middle region of SH3RF1 corresponding to a region with amino acids LLKLLSGASTKRKPRVSPPASPTLEVELGSAELPLQGAVGPELPPGGGHG</p>
