Primary Antibodies

<p>Anti-Human CGRP Monoclonal Antibody</p>

<p>Troponin I antibody (cardiac) was raised in goat using human cardiac troponin I as the immunogen.</p>

<p>HSV2 gD antibody was raised in mouse using herpes simplex virus 2 glycoprotein D (gD) as the immunogen.</p>

<p>Rabbit polyclonal CD4 (T-cell) antibody (FITC)</p>

<p>Troponin T antibody was raised in mouse using human cardiac troponin T as the immunogen.</p>

<p>Mouse monoclonal SIV mac251 gp120 antibody (HRP)</p>

<p>Mumps virus antibody was raised in mouse using mumps virus as the immunogen.</p>

<p>HTLV-1 antibody (FITC) was raised in mouse using HTLV-1 (DIVmac251) as the immunogen.</p>

<p>The HRP2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It has a high affinity for streptavidin and can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. This antibody specifically targets the hepatocyte growth factor (HGF) and can neutralize its activity. Additionally, it has been shown to bind to other growth factors such as trastuzumab, transferrin, and epidermal growth factor (EGF). The HRP2 antibody is also capable of inhibiting the activity of tumor necrosis factor-alpha (TNF-α), which plays a crucial role in inflammation. With its ability to specifically target activated CXCR4 receptors, this antibody holds great potential in cancer research and therapeutics.</p>

<p>CMV p28 UL99 antibody was raised in mouse using cytomegalovirus minor capsid protein p28 as the immunogen.</p>

<p>HIV2 p26 antibody was raised in mouse using purified, full length recombinant p26 (HIV-2 ROD) produced in E. coli expression system as the immunogen.</p>

<p>Epitestosterone antibody was raised in rabbit using protein-3-oxime-epitestosterone conjugate as the immunogen.</p>

<p>Mouse monoclonal Measles Virus Nucleoprotein antibody (FITC)</p>

<p>Polyclonal SIV mac251 gp28 antibody (biotin)</p>

<p>Rabbit polyclonal anti-tat HIV1 antibody (Biotin)</p>

<p>This mouse monoclonal antibody is complementary to the Zika envelope protein, with batches of the IgG1k immunoglobulin subclass available. It has been purified by DEAE column chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.&lt;/p&gt; &lt;p&gt;Transmitted by infected mosquitoes, the Zika virus, although it causes asymptotic and mild symptoms in the majority of cases, it can lead to neurological complications and Guillain-Barr&amp;eacute; syndrome in adults. Furthermore during pregnancy, infants may be born with microcephaly and congenital malformations, known as Zika syndrome. The envelope protein located on the Zika viral membrane and to which this mouse Mab is complementary, is involved in virus and host cell surface receptor binding. It has 3 domains (I, II and III) and a stem-transmembrane domain. Domain I functions to link Domain III (which is the host cell receptor binding domain) to Domain II in order to dimerise and form a fusion loop.&lt;/p&gt; &lt;p&gt;The accessible location of the Envelope protein on the viral membrane means it can be an important target for neutralising antibodies and vaccine development. This product can further be used in the rapid lateral flow detection of Zika envelope protein and other antibody and antigen interaction dependent assays such as ELISA and western blot.</p>

<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>