Primary Antibodies

<p>Donkey anti-chicken IgY (H + L) (HRP) was raised in donkey using chicken IgG (H &amp; L) as the immunogen.</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>MYBPH antibody was raised using the N terminal of MYBPH corresponding to a region with amino acids LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP</p>

<p>Rabbit polyclonal ZNF611 antibody</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>

<p>FGF18 antibody is a polyclonal antibody that targets fibroblast growth factor 18 (FGF18). FGF18 is involved in various biological processes, including hepatocyte growth, tissue repair, and development. This antibody has been shown to have high specificity and affinity for FGF18, making it a valuable tool in life sciences research.</p>

<p>ELOF1 antibody was raised in rabbit using the middle region of ELOF1 as the immunogen</p>

<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>Goat anti Human IgE antibody</p>

<p>EVX1 antibody was raised in rabbit using the middle region of EVX1 as the immunogen</p>

<p>The DGKA antibody is a highly specific monoclonal antibody that targets the octanoyltransferase enzyme. It is widely used in various assays and research studies in the field of life sciences. This antibody plays a crucial role in identifying and analyzing the function of DGKA, which is involved in several important cellular processes.</p>

<p>PEX5 antibody was raised using the middle region of PEX5 corresponding to a region with amino acids LNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLL</p>

<p>GPR37L1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The PCBP2 antibody is a highly specialized Polyclonal Antibody that has neutralizing properties against enzyme activities. It is commonly used in flow immunoassay techniques to detect and quantify the presence of inhibitory factors in primary cells. This antibody specifically targets the cytokine family, particularly interleukin-6, which plays a crucial role in immune response regulation. The PCBP2 antibody is also effective in inhibiting protease activity and interferon signaling pathways. Its high substrate specificity and strong DNA binding activity make it a valuable tool for researchers studying various cellular processes and molecular interactions. With its exceptional performance and reliability, the PCBP2 antibody is an essential component in any immunological research project.</p>

<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>

<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>