Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75602 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
CD45 antibody (FITC)
CD45 antibody (FITC) was raised in mouse using chicken CD45 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molTRNT1 antibody
TRNT1 antibody was raised using the N terminal of TRNT1 corresponding to a region with amino acids PQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITT
RSV antibody
RSV antibody was raised in rabbit using Residues 81-95 [LESYIGSINNITKQSA] of the human RSV M2 protein as the immunogen.Purity:Min. 95%CD44 antibody (Spectral Red)
CD44 antibody (Spectral Red) was raised in mouse using chicken CD44 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molCD3e antibody (Spectral Red)
CD3e antibody (Spectral Red) was raised in rat using CD3e as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molSHP2 antibody
The SHP2 antibody is a monoclonal antibody that specifically targets SHP2, a protein involved in various cellular processes. It has been extensively studied in the field of Life Sciences and has shown promising results in different applications.Purity:Min. 95%IGFBP3 antibody
The IGFBP3 antibody is a highly specialized antibody used in Life Sciences research. It is immobilized and specifically designed to target and bind to the IGFBP3 antigen. This monoclonal antibody has been extensively tested and validated for its specificity and sensitivity in detecting IGFBP3 in various experimental settings.
Purity:Min. 95%
