Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
SPTLC1 antibody
The SPTLC1 antibody is a highly specialized polyclonal antibody that plays a crucial role in various life science applications. It is designed to target and bind to the SPTLC1 protein, which is involved in the synthesis of sphingolipids, an essential component of cell membranes.
MST1R antibody
MST1R antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%SLC18A2 antibody
The SLC18A2 antibody is a monoclonal antibody that specifically targets the protein encoded by the SLC18A2 gene. This gene encodes a glycoprotein that functions as a vesicular monoamine transporter, responsible for transporting neurotransmitters such as dopamine, norepinephrine, and serotonin into synaptic vesicles. The SLC18A2 antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.CD11b antibody (PE)
CD11b antibody (biotin) was raised in rat using peritoneal macrophages from C57 B1/6 x DBA/2 F1 hybrid mice as the immunogen.
Purity:Min. 95%CD38 antibody
CD38 antibody was raised in rabbit using the C terminal of CD38 as the immunogenPurity:Min. 95%ZHX2 antibody
The ZHX2 antibody is a highly specialized product in the field of Life Sciences. It is specifically designed to neutralize lipoprotein lipase, an enzyme involved in lipid metabolism. This antibody can be used as a research tool to study the function and regulation of lipoprotein lipase in various biological systems.
PLOD2 antibody
PLOD2 antibody was raised using the middle region of PLOD2 corresponding to a region with amino acids IKGKTLRSEMNERNYFVRDKLDPDMALCRNAREMTLQREKDSPTPETFQM
Purity:Min. 95%Donkey anti Rabbit IgG (H + L) (rhodamine)
Donkey anti-rabbit IgG (H+L) (Rhodamine) was raised in donkey using rabbit IgG whole molecule as the immunogen.
Purity:Min. 95%STK39 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds in Mycobacterium tuberculosis strains. This bactericidal drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Metabolized through various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid, this drug shows remarkable potential in treating tuberculosis infections.
Fibrinopeptide A antibody
Fibrinopeptide A antibody was raised in mouse using Fibrinopeptide A conjugated with carrier protein as the immunogen.
Goat anti Rabbit IgG (HRP)
Goat anti-rabbit IgG (HRP) was raised in goat using rabbit IgG F(c) fragment as the immunogen.Purity:Min. 95%H2B antibody
The H2B antibody is a polyclonal antibody that has neutralizing properties. It is used in the field of Life Sciences to study various aspects of cellular biology. This antibody specifically targets the interferon-gamma (IFN-gamma) pathway, which plays a crucial role in immune responses and viral infections. The H2B antibody can be used to detect and quantify virus surface antigens, as well as nuclear proteins involved in gene regulation. Additionally, this antibody has been shown to interact with fatty acid-binding proteins and serine proteases, suggesting its involvement in lipid metabolism and protein processing pathways. Whether you need a monoclonal or polyclonal antibody for your research, the H2B antibody is a reliable tool that provides accurate and reproducible results.
Purity:Min. 95%FBXL3 antibody
FBXL3 antibody was raised using the middle region of FBXL3 corresponding to a region with amino acids LISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLV
