Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
CD122 antibody
The CD122 antibody is a highly effective tool used in Life Sciences research. This antibody specifically targets and binds to CD122 receptors, which are found on various cell types including immune cells, endothelial cells, and collagen-producing cells. By binding to CD122 receptors, this antibody modulates the signaling pathways involved in cell growth, differentiation, and survival.
STAT1 antibody
The STAT1 antibody is a specific antibody used in life sciences research. It targets the STAT1 protein, which plays a crucial role in various cellular processes such as immune response and cell growth. This monoclonal antibody can be used to study the activation of p38 MAPK signaling pathway and its effects on mesenchymal stem cells. Additionally, it has been shown to neutralize the effects of hepcidin, a key regulator of iron metabolism. The STAT1 antibody can also be used to investigate the role of interleukin-6 and cannabinoid receptors in different biological systems. Its genotoxic properties make it an essential tool for studying DNA damage and repair mechanisms. With its high specificity and potency, this antibody is widely used by researchers in various fields of life sciences.
TNFSF9 antibody
The TNFSF9 antibody is a highly specialized product used in the field of Life Sciences. This monoclonal antibody is designed to target and neutralize TNFSF9, a growth factor involved in various biological processes. The antibody has been extensively modified to enhance its efficacy and specificity, including acid modifications and glycosylation.
SSR3 antibody
The SSR3 antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets the nuclear receptor GLP-1 and has been widely used in various assays and experiments. The SSR3 antibody is highly specific and exhibits high affinity for its target, making it an ideal tool for studying the functions of GLP-1. This antibody has been successfully used in experiments involving electrode-based techniques, such as patch-clamp recordings, as well as in immunoassays to detect GLP-1 levels in human serum samples. Additionally, the SSR3 antibody has shown efficacy in cytotoxicity assays and has been used to study the effects of GLP-1 on cell growth and survival. Its versatility and reliability make it a valuable tool for researchers working in the field of Life Sciences.
OGDH antibody
OGDH antibody was raised using the N terminal of OGDH corresponding to a region with amino acids MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFL
EPS8L1 antibody
EPS8L1 antibody was raised using the N terminal of EPS8L1 corresponding to a region with amino acids QRDRSPAAETPPLQRRPSVRAVISTVERGAGRGRPQAKPIPEAEEAQRPE
MUC2 antibody
The MUC2 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It targets the MUC2 protein, which plays a crucial role in maintaining the integrity of the mucosal barrier in various tissues. This antibody can be used for research purposes to study the function and regulation of MUC2 in different biological processes.
ZFP91 antibody
ZFP91 antibody was raised in rabbit using the N terminal of ZFP91 as the immunogen
Purity:Min. 95%PDPN antibody
The PDPN antibody is a monoclonal antibody used in the field of Life Sciences. It is commonly known as an antiphospholipid antibody and has been extensively studied for its role in various biological processes. This antibody specifically targets podoplanin, a glycoprotein expressed on the surface of many cell types.
Vav antibody
The Vav antibody is a polyclonal antibody that specifically targets the Vav protein. This antibody is widely used in life sciences research to study the role of Vav in various cellular processes. The Vav protein is involved in signal transduction pathways, particularly those mediated by TGF-beta and growth factors. It plays a crucial role in regulating cell proliferation, differentiation, and apoptosis.
Purity:Min. 95%HIF3A antibody
HIF3A antibody was raised in rabbit using the C terminal of HIF3A as the immunogen
Purity:Min. 95%USP4 antibody
USP4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%
