Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
GBA antibody
The GBA antibody is a polyclonal antibody that specifically targets the primary amino acid sequence of the glucocerebrosidase (GBA) enzyme. This antibody is derived from human serum and has been extensively validated for its specificity and sensitivity. It can be used in various applications, including enzyme-linked immunosorbent assays (ELISAs), Western blotting, and immunohistochemistry.
NSUN2 antibody
NSUN2 antibody was raised using the C terminal of NSUN2 corresponding to a region with amino acids FINSRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEP
CD32 antibody (Fab 2)
CD32 antibody (Fab'2) was raised in mouse using human K562 tumor cells and L cells tranfected with human Fc gamma RII as the immunogen.
Collagen Type I antibody
Collagen type I antibody was raised in rabbit using type I collagen purified from fetal mouse skin as the immunogen.Purity:Min. 95%ZNF326 antibody
ZNF326 antibody was raised in rabbit using the C terminal of ZNF326 as the immunogen
Purity:Min. 95%Mycoplasma pneumoniae antibody
Mycoplasma pneumoniae antibody is a specialized protein that targets the circumsporozoite protein of the bacteria. This antibody has been shown to have anti-glial fibrillary acidic properties, acting as a growth factor and neurotrophic agent. It is a monoclonal antibody that specifically neutralizes Mycoplasma pneumoniae and has been extensively studied in the field of Life Sciences. The antibody has also been found to exhibit tyrosine phosphatase activity and has potential neuroprotective effects. With its unique properties, this Mycoplasma pneumoniae antibody offers promising applications in various research areas and can be a valuable tool for scientists studying antibodies and their functions.
BBS5 antibody
BBS5 antibody was raised using the middle region of BBS5 corresponding to a region with amino acids VEIDSDGHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLW
BP1 antibody
The BP1 antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. This antibody specifically targets and binds to BP1, a protein that is found in human serum. The binding of the BP1 antibody to its target protein can be used for various applications, including research and diagnostic purposes.
