Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
Chlorpyrifos antibody
The Chlorpyrifos Antibody is a powerful inhibitory factor that targets antiphospholipid antibodies. This monoclonal antibody has neutralizing properties and is widely used in Life Sciences research. It specifically binds to GM-CSF (granulocyte-macrophage colony-stimulating factor), chemokines, interferons, and E-cadherin. The Chlorpyrifos Antibody can effectively induce lysis of cells expressing these markers and has been extensively tested for its efficacy. It contains excipients to ensure stability and potency. Additionally, this antibody has shown promising results in targeting alpha-fetoprotein, making it a valuable tool in the development of diagnostic and therapeutic applications.
SLC5A9 antibody
SLC5A9 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%EHD4 antibody
EHD4 antibody was raised using the middle region of EHD4 corresponding to a region with amino acids LMNLISQEETSTPTQLVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVA
Factor XI antibody
Factor XI antibody is a highly specialized antibody used in the field of Life Sciences. It belongs to the class of monoclonal antibodies and is specifically designed to target and bind to Factor XI, a growth factor involved in various physiological processes. This antibody can be used in research settings to study the role of Factor XI in insulin signaling pathways, glycosylation processes, and epidermal growth factor regulation.
Mouse Thymocyte antibody
Mouse thymocyte antibody was raised in rabbit using RBC-free murine thymus and spleen cells as the immunogen.Purity:Min. 95%anti-Canine Parvovirus Antibody
Canine parvovirus (CPV) is a highly contagious viral infection that affects dogs, especially puppies and young dogs. The virus belongs to the Parvoviridae family and is closely related to feline panleukopenia virus (FPV), which affects cats.;This Monoclonal anti-Canine Parvovirus antibody is suitable for ELISA and LFD applications. Suggest using as capture antibody in LFD format.Purity:Min. 95%Complement C2 antibody
Complement C2 antibody was raised using the middle region of C2 corresponding to a region with amino acids INQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQ
LGALS3 antibody
LGALS3 antibody was raised using the N terminal of LGALS3 corresponding to a region with amino acids GASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPG
