Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
PSA antibody (HRP)
PSA antibody (HRP) was raised in mouse using highly pure human PSA as the immunogen.Purity:Min. 95%Annexin A5 antibody
Annexin A5 antibody was raised using the N terminal of ANXA5 corresponding to a region with amino acids SELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPE
STK4 antibody
The STK4 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets mycoplasma genitalium and has been shown to neutralize its effects. This antibody can be used in various applications, including the study of epidermal growth factor and collagen. Additionally, it has been found to have inhibitory properties against other growth factors such as TGF-beta. The STK4 antibody is also cytotoxic and can induce lysis in targeted cells. Researchers can use this antibody to investigate the role of specific proteins or pathways in cellular processes and disease development.
Notch 1 antibody
The Notch 1 antibody is a substance used in Life Sciences research and development. It is specifically designed to target and bind to the Notch 1 antigen, which plays a crucial role in cell signaling and development. By inhibiting the activity of Notch 1, this antibody can help researchers gain a better understanding of various biological processes.
HSF2 antibody
The HSF2 antibody is a biomolecule widely used in Life Sciences research. It plays a crucial role in various applications such as electrophoresis, neutralizing specific proteins or molecules, and measuring microvessel density. This antibody has shown promising results in inhibiting the activity of erythropoietin, a growth factor involved in red blood cell production. Additionally, it has been used as an immunosuppressant and is commonly employed in immunoassays to detect specific targets. The HSF2 antibody exhibits cytotoxic properties and can be utilized as a tool for targeted therapy. It is available as a monoclonal antibody and can be combined with other colloidal inhibitors for enhanced efficacy. Researchers also explore the potential of this antibody as a natriuretic agent due to its ability to regulate fluid balance within the body.
CD19 antibody (PE-CY7)
CD19 antibody (PE-CY7) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molBbs1 antibody
Bbs1 antibody was raised in rabbit using the N terminal of Bbs1 as the immunogen
Purity:Min. 95%CD106 antibody (PE)
CD106 antibody (PE) was raised in rat using murine CD106/VCAM-1 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molH2AFY2 antibody
H2AFY2 antibody was raised using the middle region of H2AFY2 corresponding to a region with amino acids KKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLV
PVRL2 antibody
The PVRL2 antibody is a highly specialized antibody that targets the PVRL2 protein. This protein plays a crucial role in various biological processes, including cell adhesion, immune response, and signal transduction. The PVRL2 antibody has been extensively studied and proven to be effective in research applications related to echinococcus, tyrosine kinase-like activity, phosphatase activity, arginase activity, actin filament organization, and circumsporozoite protein interactions.
