Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
Hamster Lymphocyte antibody
Hamster lymphocyte antibody was raised in rabbit using RBC-free hamster thymus and spleen cells as the immunogen.Purity:Min. 95%Borrelia burgdorferi antibody
Borrelia burgdorferi antibody was raised in rabbit using a whole cell preparation from Borrelia burgdorferi as the immunogen.Purity:Min. 95%Rabbit anti Bovine IgG (biotin)
Rabbit anti-bovine IgG (biotin) was raised in rabbit using bovine IgG F(c) fragment as the immunogen.Purity:Min. 95%RTN4 antibody
RTN4 antibody was raised using the middle region of RTN4 corresponding to a region with amino acids FRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTI
Purity:Min. 95%Goat anti Cat IgG (H + L)
Goat anti-cat IgG (H+L) was raised in goat using feline IgG whole molecule as the immunogen.
Purity:Min. 95%KIF9 antibody
KIF9 antibody was raised using the N terminal of KIF9 corresponding to a region with amino acids MGTRKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQPurity:Min. 95%Helicobacter pylori antibody
Helicobacter pylori antibody was raised in mouse using purified H. pylori antigen as the immunogen.XRCC4 antibody
The XRCC4 antibody is a highly specific monoclonal antibody that has an inhibitory effect on the progesterone concentration in human serum. It exhibits strong antioxidant activity and has been shown to neutralize autoantibodies and anti-drug antibodies. The XRCC4 antibody is widely used in various assays, particularly in Life Sciences research, for its ability to detect and quantify specific proteins of interest. This monoclonal antibody is colloidal gold-labeled, making it suitable for use in immunohistochemical staining and other applications requiring high sensitivity and specificity. Additionally, the XRCC4 antibody has been found to be effective in detecting granulosa cell tumors due to its binding affinity with mesothelin, a protein commonly expressed in these types of tumors. Its versatility and reliability make it an essential tool for researchers studying steroid hormones and related biological processes.
HSPB8 antibody
HSPB8 antibody was raised using the middle region of HSPB8 corresponding to a region with amino acids PEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFA
FAM62B antibody
FAM62B antibody was raised using a synthetic peptide corresponding to a region with amino acids NSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEGRKTSIKS
Purity:Min. 95%PF4 antibody
PF4 antibody was raised in rabbit using highly pure recombinant hPF-4 as the immunogen.Purity:Min. 95%CD8B antibody
CD8B antibody was raised using the N terminal of CD8B corresponding to a region with amino acids RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI
Purity:Min. 95%TCF25 antibody
TCF25 antibody was raised in rabbit using the N terminal of TCF25 as the immunogen
Purity:Min. 95%Rabbit anti Cat IgG
Rabbit anti-cat IgG was raised in rabbit using feline IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%MAP2K2 antibody
MAP2K2 antibody was raised using the N terminal of MAP2K2 corresponding to a region with amino acids LARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELELDEQQK
Fam55d antibody
Fam55d antibody was raised in rabbit using the C terminal of Fam55d as the immunogen
Purity:Min. 95%CD56 antibody
The CD56 antibody is a monoclonal antibody that targets the CD56 glycoprotein. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. The CD56 antibody specifically binds to CD56, which is expressed on natural killer cells, T cells, and some subsets of B cells. This binding activates protein kinase pathways, leading to cytotoxicity and apoptosis of target cells.
Purity:Min. 95%
