Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
DPH2 antibody
DPH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTGSKMFILGDTAYGSCCVDVLGAEQAGAQALIHFGPACLSPPARPLPVA
SSH3 antibody
The SSH3 antibody is a highly specialized product in the field of Life Sciences. It is an amino-terminal activated antibody that is commonly used in research and diagnostic applications. This antibody specifically targets and binds to various proteins, such as annexin, chemokine, glucagon, and natriuretic peptides. The SSH3 antibody has been extensively tested and validated for its high specificity and sensitivity.
ISL1 antibody
ISL1 antibody was raised in Mouse using a purified recombinant fragment of human ISL1 expressed in E. coli as the immunogen.Rabbit anti Sheep IgG (Alk Phos)
Rabbit anti-sheep IgG (Alk Phos) was raised in rabbit using sheep IgG F(c) fragment as the immunogen.
Purity:Min. 95%CO1 antibody
The CO1 antibody is a monoclonal antibody that specifically targets and neutralizes the CO1 protein. This protein is involved in various biological processes, including the regulation of brain natriuretic peptide levels and interferon production. The CO1 antibody has been extensively studied in Life Sciences research and has shown promising results as an antiviral agent. It can be used in laboratory experiments to study the function of the CO1 protein or as a potential therapeutic option for certain diseases. The CO1 antibody is formulated with high-quality excipients to ensure stability and efficacy. Additionally, polyclonal antibodies are also available for researchers who require a broader range of target recognition. Trust the CO1 antibody for reliable and accurate results in your scientific endeavors.
C5 antibody
The C5 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the glucose transporter on actin filaments. This antibody has been extensively studied and proven to be highly effective in various applications.
Arginase I antibody
The Arginase I antibody is a highly effective monoclonal antibody that targets the protein complex responsible for the breakdown of arginine. It has been shown to have excellent colloidal properties, making it ideal for use in various applications. This antibody specifically binds to extracellular polysaccharides and can be used in both research and diagnostic settings.
