Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75512 products of "Primary Antibodies"
LRRC24 antibody
LRRC24 antibody was raised using the N terminal of LRRC24 corresponding to a region with amino acids HLPRLQELHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISREALQPL
Purity:Min. 95%Mouse anti Human IgA
IgA antibody was raised in Mouse using recombinant human IgA2 as the immunogen.Purity:Min. 95%Morphine antibody
Morphine antibody was raised in mouse using Morphine-3-BSA as the immunogen.Purity:Min. 95%hCG beta antibody
hCG beta antibody is a glycosylated monoclonal antibody that acts as a growth factor inhibitor. It has the ability to neutralize the activity of hCG beta, which is involved in various biological processes such as pregnancy and tumor growth. This antibody specifically targets the influenza hemagglutinin and inhibits its function, thereby preventing viral entry into host cells. Additionally, hCG beta antibody has been shown to inhibit protein kinase activity and interfere with interferon signaling pathways. It also exhibits necrosis factor-related apoptosis-inducing properties, promoting cell death in activated cells. With its unique characteristics and mechanisms of action, hCG beta antibody is a valuable tool for research and therapeutic applications.
Purity:Min. 95%Goat anti Rabbit IgG (H + L) (Fab'2) (HRP)
Goat anti-rabbit IgG (H+L) (Fab'2) (HRP) was raised in goat using rabbit IgG, whole molecule as the immunogen.
Purity:Min. 95%Goat anti Human IgG (H + L) (FITC)
Goat anti-human IgG (H+L) (FITC) was raised in goat using human IgG whole molecule as the immunogen.
Purity:Min. 95%BD3 antibody
BD3 antibody was raised in rabbit using highly pure recombinant human BD-3 as the immunogen.Purity:Min. 95%MKK6 antibody
The MKK6 antibody is a highly specialized polyclonal antibody used in Life Sciences research. It specifically targets the activated form of MKK6, a key enzyme involved in the natriuretic signaling pathway. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting MKK6 activation in various experimental settings.
Purity:Min. 95%Mouse anti Human IgM
IgM antibody was raised in Mouse using recombinant human IgM as the immunogen.
Purity:Min. 95%Rbm3 antibody
Rbm3 antibody was raised in rabbit using the N terminal of Rbm3 as the immunogen
Purity:Min. 95%Beta Tubulin 2A antibody
Beta Tubulin 2A antibody was raised using the middle region of TUBB2A corresponding to a region with amino acids AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAAC
PSMC5 antibody
PSMC5 antibody was raised in rabbit using the C terminal of PSMC5 as the immunogen
Purity:Min. 95%MST1R antibody
MST1R antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%CD117 antibody (PE)
CD117 antibody (PE) was raised in mouse using human MO7e tumor cells as the immunogen.
Purity:Min. 95%ZNF567 antibody
ZNF567 antibody was raised in rabbit using the N terminal of ZNF567 as the immunogenPurity:Min. 95%
