Primary Antibodies

The K2 antibody is a highly effective nucleotide molecule that targets alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's and Alzheimer's. This anti-her2 antibody-drug conjugate specifically binds to the HER2 receptor, which is overexpressed in certain types of cancer cells. It works by inhibiting the epidermal growth factor signaling pathway, preventing the growth and proliferation of cancer cells.

The DUSP3 antibody is a multidrug antibody that targets TGF-beta, a key signaling molecule involved in various cellular processes. This antibody can be used in life sciences research to study the effects of TGF-beta on different cell types. It has been shown to neutralize the activity of TGF-beta and inhibit its downstream signaling pathways. Additionally, the DUSP3 antibody has been found to have inhibitory effects on collagen production, epidermal growth factor signaling, vasoactive intestinal peptide activity, interferon production, and TNF-alpha signaling. With its wide range of applications and potent neutralizing properties, the DUSP3 antibody is a valuable tool for researchers studying TGF-beta-related processes and diseases.

COL25A1 antibody was raised in Rabbit using Human COL25A1 as the immunogen

CD3 antibody (Allophycocyanin-CY7) was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.

Affinity purified Rabbit polyclonal LIMCH1 antibody

The GPR1 antibody is a monoclonal antibody that specifically targets the epidermal growth factor receptor (EGFR). It belongs to the family of EGFR-like antibodies and has been shown to have neutralizing effects on the activity of EGFR. This antibody can be used in various research applications, including immunohistochemistry and Western blotting, to study the role of EGFR in cell signaling pathways. Additionally, the GPR1 antibody has been used to investigate the interactions between EGFR and other molecules, such as fibronectin and chemokines. Its high specificity and affinity make it a valuable tool for researchers in the field of life sciences studying growth factors and their associated signaling pathways.

Rabbit polyclonal PPP1R1B antibody

IL9 antibody was raised in Rabbit using Human IL9 as the immunogen

GCLM antibody was raised in Rabbit using Human GCLM as the immunogen

Rabbit anti-goat IgG (H+L) (Rhodamine) was raised in rabbit using goat IgG whole molecule as the immunogen.

MAP2K6 antibody was raised in Rabbit using Human MAP2K6 as the immunogen

EGFR antibody was raised in Rabbit using Human EGFR as the immunogen

SAE1 antibody was raised using the N terminal of SAE1 corresponding to a region with amino acids MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAE

Rabbit polyclonal ZNF774 antibody

The B7H4 antibody is a monoclonal antibody that targets the B7H4 protein, which is expressed on the surface of tumor cells. This antibody has been shown to have potent anti-tumor activity and can effectively inhibit tumor growth. It works by blocking the interaction between B7H4 and its receptor, preventing the suppression of immune responses against tumor cells. In addition, the B7H4 antibody has been found to enhance the production of interferon-gamma (IFN-gamma) and interleukin-6 (IL-6), which are important cytokines involved in immune regulation. This antibody is highly specific for human B7H4 and does not cross-react with other proteins. It has been extensively tested in various preclinical models and has shown promising results in terms of efficacy and safety. The B7H4 antibody is a valuable tool for researchers in the field of Life Sciences who are studying tumor immunology and developing novel cancer therapies.

FOXM1 antibody was raised in rabbit using the N terminal of FOXM1 as the immunogen

The N Cadherin antibody is a trifunctional antibody that has various applications in the field of Life Sciences. It can be used for research purposes, such as studying growth factors and their interactions with human serum. This antibody is commonly used in laboratory settings and can be used in experiments involving electrodes and other scientific equipment.

This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.