Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75459 products of "Primary Antibodies"
Ovalbumin antibody
The Ovalbumin antibody is a polyclonal antibody that specifically targets the ovalbumin protein. Ovalbumin is a basic protein found in egg whites and is commonly used in life sciences research as a model antigen. This antibody has been developed to bind to the CD3 receptor, which is expressed on T cells, making it an ideal tool for studying T cell activation and function. The Ovalbumin antibody is reactive and can be used in various applications such as immunohistochemistry, flow cytometry, and Western blotting. It can also be used as a diagnostic reagent for detecting ovalbumin or related proteins in human serum samples. Additionally, this antibody has neutralizing properties and can inhibit the activity of TNF-related apoptosis-inducing ligand (TRAIL), making it a valuable tool for studying cell death pathways. With its high specificity and affinity, the Ovalbumin antibody is an essential tool for researchers working in the field of immunology and molecular biology.
SLC7A8 antibody
SLC7A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA
CHRNB3 antibody
CHRNB3 antibody was raised in rabbit using the middle region of CHRNB3 as the immunogen
HNRPLL antibody
HNRPLL antibody was raised using the N terminal of HNRPLL corresponding to a region with amino acids RLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHHKVS
STMN1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds with bactericidal activity. Through extensive research, it has been determined that this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication.
PPCDC antibody
PPCDC antibody was raised using the N terminal of PPCDC corresponding to a region with amino acids VTTERAKHFYSPQDIPVTLYSDADEWEIWKSRSDPVLHIDLRRWADLLLV
LOXL2 antibody
The LOXL2 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and binds to LOXL2, a protein involved in various biological processes. This antibody has been extensively studied and proven to be effective in detecting and quantifying LOXL2 levels in different samples.
BAD antibody
The BAD antibody is a polyclonal antibody that specifically targets the BAD protein. BAD (Bcl-2 associated death promoter) is a key regulator of apoptosis, or programmed cell death. This antibody is widely used in life sciences research to study the role of BAD in various cellular processes.
