Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
Tyrosine Hydroxylase antibody
The Tyrosine Hydroxylase antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets and detects tyrosine hydroxylase, an enzyme involved in the synthesis of dopamine, a neurotransmitter that plays a crucial role in various physiological processes. The Tyrosine Hydroxylase antibody recognizes an epitope located within the protein sequence of tyrosine hydroxylase, allowing for precise and accurate detection.
DONSON antibody
DONSON antibody was raised using the middle region of DONSON corresponding to a region with amino acids DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE
Plasminogen antibody (HRP)
Plasminogen antibody (HRP) was raised in goat using human plasminogen purified from plasma as the immunogen.CRELD1 antibody
CRELD1 antibody was raised using the C terminal of CRELD1 corresponding to a region with amino acids TEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTE
MVP antibody
The MVP antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to dinitrophenyl (DNP) antigens, making it a valuable tool for studying immune responses. This antibody has been shown to have neutralizing effects on interferon and endothelial growth factors, inhibiting their activity. Additionally, the MVP antibody has been found to induce lysis of target cells in the presence of complement or human serum. Its ability to inhibit caspase-9 activation suggests a potential role in apoptosis regulation. Furthermore, this monoclonal antibody has been shown to immobilize β-catenin, an important protein involved in cell adhesion and signaling pathways. These unique characteristics make the MVP antibody an essential tool for researchers studying antiangiogenic and growth factor-related processes in various biological systems.
p63 antibody
The p63 antibody is a highly specialized antibody used in the field of Life Sciences. It is a nuclear antibody that reacts specifically with p63 protein, an essential regulator of cell growth and development. This polyclonal antibody is designed to recognize and bind to the activated form of p63 in various biological samples.
ICAM2 antibody
ICAM2 antibody is a growth factor that plays a crucial role in various cellular processes. It has been shown to be involved in the regulation of immune responses, cell adhesion, and signal transduction. This antibody specifically targets ICAM2, an antigen expressed on the surface of cells.
ARD1A antibody
ARD1A antibody was raised using a synthetic peptide corresponding to a region with amino acids VESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSE
