Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75448 products of "Primary Antibodies"
BRM antibody
The BRM antibody is a monoclonal antibody used in Life Sciences for its antiviral properties. It is an inhibitor that targets specific virus surface antigens, preventing their interaction with host cells and inhibiting viral replication. This antibody has shown high efficacy against a wide range of viruses, including those causing respiratory infections, influenza, and herpes.
RALA antibody
The RALA antibody is a glycopeptide that acts as an anticoagulant by neutralizing the viscosity of fibrinogen. It belongs to the class of peptide agents known as antibodies, which are widely used in Life Sciences research. This antibody specifically binds to glycan-binding proteins and has been shown to have toxic effects on various cell types. Additionally, it has been found to inhibit the activity of colony-stimulating factors such as interleukin-6, making it a valuable tool for studying immune responses and cell signaling pathways. The RALA antibody is a polyclonal antibody, meaning it recognizes multiple epitopes on its target protein, increasing its versatility in experimental applications.
MMP10 antibody
The MMP10 antibody is a polyclonal antibody that is used in immunohistochemical studies to detect the presence of matrix metalloproteinase 10 (MMP10) protein. This antibody is widely used in life sciences research to study various cellular processes, including pluripotent stem cell differentiation and hematopoietic development. The MMP10 antibody can be used as a valuable tool for researchers to investigate the expression and localization of MMP10 in different tissues and cell types. It can also be used to inhibit the activity of MMP10 or as a therapeutic reagent in the development of new cytokine inhibitors. With its high specificity and sensitivity, the MMP10 antibody is an essential component for any researcher working in the field of molecular biology and immunology.
Factor XIII B Polypeptide antibody
Factor XIII B Polypeptide antibody was raised using the middle region of F13B corresponding to a region with amino acids LRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGSDLIQCYNFGWYPESP
Purity:Min. 95%Goat anti Mouse IgM (biotin)
Goat anti-mouse IgM (biotin) was raised in goat using murine IgM heavy chain as the immunogen.
Purity:Min. 95%DLC1 antibody
DLC1 antibody was raised using the C terminal of DLC1 corresponding to a region with amino acids NLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGL
CD117 antibody (Spectral Red)
CD117 antibody (biotin) was raised in rat using murine CD117/c-Kit as the immunogen.
Purity:Min. 95%beta Galactosidase antibody
The beta Galactosidase antibody is a powerful tool used in various research applications. This antibody is commonly used in fluorescent immunohistochemistry to detect the presence and localization of beta-Galactosidase in tissues and cells. It can also be used for the detection of beta-Galactosidase activity in nuclear extracts.
GCP2 antibody
The GCP2 antibody is a highly specific antibody that targets collagen and neutralizes the activity of autoantibodies. It is commonly used in Life Sciences research to study the role of TNF-α, growth factors, and chemokines in various biological processes. This polyclonal antibody has been shown to effectively bind to activated fibronectin and inhibit the activity of TGF-beta. With its high specificity and affinity, the GCP2 antibody is a valuable tool for researchers studying the molecular mechanisms underlying various diseases and physiological processes.
FANCC antibody
The FANCC antibody is a highly specialized product that is used in various assays and research applications within the field of Life Sciences. It is an antibody that specifically targets and detects the FANCC protein, which plays a crucial role in DNA repair and maintenance of genomic stability. This antibody is widely used in studies related to collagen, autoantibodies, dopamine, pluripotent stem cells, fetal hemoglobin, heparin cofactor, zinc chelators, and acid residues.
Complement C1q antibody
Complement C1q antibody was raised in mouse using human complement C1q as the immunogen.
