Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75448 products of "Primary Antibodies"
SIVA1 antibody
The SIVA1 antibody is a highly specific monoclonal antibody that targets the biomolecule SIVA1. It is derived from isolated nucleic acids and collagen, making it a powerful tool for research in the field of Life Sciences. The SIVA1 antibody has been developed using cell hybridomas and chromatographic techniques to ensure high purity and specificity. It binds to hyaluronan receptors on the cell-extracellular matrix interface, allowing for precise detection and analysis of SIVA1 in various biological samples. This specific antibody can be used in applications such as immunohistochemistry, Western blotting, and ELISA assays to study the function and expression of SIVA1 in different cellular contexts. With its exceptional sensitivity and selectivity, the SIVA1 antibody is an invaluable asset for scientists seeking to unravel the complexities of cellular signaling pathways and protein interactions.
OXTR antibody
OXTR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%Tau antibody
The Tau antibody is a powerful tool in Life Sciences research. It is an antibody that specifically targets and binds to the protein Tau, which plays a crucial role in neurodegenerative diseases such as Alzheimer's disease. The antibody has been extensively studied and validated for its specificity and sensitivity.Purity:Min. 95%SIRT5 antibody
SIRT5 antibody was raised using the middle region of SIRT5 corresponding to a region with amino acids PICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLD
Goat anti Llama IgG (H + L) (HRP)
This antibody reacts with heavy chains on llama IgG and light chains on all llama immunoglobulins.Purity:Min. 95%Testosterone 19 antibody
Testosterone 19 antibody was raised in rabbit using testosterone-19-HSA as the immunogen.
Purity:Min. 95%PDGF Receptor alpha antibody
PDGF receptor alpha antibody was raised in rabbit using peptide corresponding to amino acids 1035-1053 (C-GKRNRHSSQTSEESAIETG) of human PDGF Receptor slpha as the immunogen.Purity:Min. 95%CDH13 antibody
The CDH13 antibody is a glycoprotein that specifically targets autoantibodies. It is a monoclonal antibody that contains a cycloalkyl group and has been shown to have cytotoxic effects. This antibody can be used in various applications, including immunohistochemistry, flow cytometry, and Western blotting. The CDH13 antibody has been used in research studies to investigate the role of CDH13 in different biological processes, such as cell adhesion and migration. It has also been used in combination with other antibodies, such as anti-CD33 antibody or sorafenib, to enhance its therapeutic potential. The CDH13 antibody has shown promising results in preclinical studies, demonstrating its ability to induce hemolysis and necrosis factor-related apoptosis-inducing effects on target cells. With its wide range of applications and potential therapeutic benefits, the CDH13 antibody is an essential tool for researchers in the field of Life Sciences.
