Primary Antibodies

The TOPK antibody is a monoclonal antibody that targets the T-LAK cell-originated protein kinase (TOPK). This antibody is widely used in Life Sciences research to study the role of TOPK in various cellular processes. It has been shown to interact with chemokines, interferons, and epidermal growth factors, suggesting its involvement in immune responses and cell signaling pathways. The TOPK antibody is highly specific and can be used for applications such as immunofluorescence, Western blotting, and immunoprecipitation. Its binding to TOPK effectively inhibits its kinase activity, making it a valuable tool for studying the function of this family kinase. The TOPK antibody is available as both a monoclonal and polyclonal antibody, providing researchers with options to suit their experimental needs. Its high affinity for TOPK ensures reliable and accurate results in experiments. With its neutralizing properties, this antibody can help elucidate the molecular mechanisms underlying various diseases and aid in the

Rabbit polyclonal RPS6KC1 antibody

HPSE antibody was raised in rabbit using the N terminal of HPSE as the immunogen

Affinity purified Rabbit polyclonal XPNPEP2 antibody

The HSPA9 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets HSPA9, also known as heat shock 70kDa protein 9. This protein plays a crucial role in various cellular processes, including cell survival and apoptosis.

H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.

The RAB3D antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to the alpha-fetoprotein (AFP) in human serum. Autoantibodies against AFP have been shown to be associated with various diseases, including liver cancer and hepatocellular carcinoma.

The NR1H3 antibody is a highly specialized monoclonal antibody that targets the chemokine receptor NR1H3. This receptor plays a crucial role in the immune response to viral infections by regulating the activity of serine proteases and other key molecules involved in antiviral defense. The NR1H3 antibody has been extensively studied and proven to be effective in neutralizing the activity of NR1H3, thereby inhibiting viral replication and spread.

NUP155 antibody was raised using the N terminal of NUP155 corresponding to a region with amino acids MPSSLLGAAMPASTSAAALQEALENAGRLIDRQLQEDRMYPDLSELLMVS

The SERP1 antibody is a polyclonal antibody that targets nuclear and adipose tissues. It is widely used in life sciences research for its neutralizing properties against glycoproteins. This antibody has been shown to be effective in inhibiting connexin agents and promoting endothelial growth. It can also be used as a diagnostic tool for detecting alpha-fetoprotein levels in human serum. The SERP1 antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. With its high specificity and affinity, this antibody is an essential tool for studying various biological processes and diseases.

Guinea pig polyclonal Hemoglobin antibody (FITC)

SEMA3D antibody was raised using the middle region of SEMA3D corresponding to a region with amino acids LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS

IMPDH2 antibody was raised in Rabbit using Human IMPDH2 as the immunogen

The SYT1 antibody is a highly effective polyclonal antibody that targets angptl3, a glycoprotein involved in various biological processes. This antibody can be used in chromatographic techniques for protein purification and immobilization, making it an essential tool in life sciences research. Additionally, the SYT1 antibody has neutralizing properties against inhibitors of growth factors, such as collagen, making it a valuable asset in cytotoxic studies. Whether you're conducting experiments or developing therapeutic strategies, the SYT1 antibody is a reliable choice for your research needs.

The PSA antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of Antibodies and is specifically designed for ultrasensitive detection. This Monoclonal Antibody has undergone surface modification to ensure high specificity and sensitivity in detecting the target protein. It can be used in various applications such as flow immunoassay and electrochemical impedance spectroscopy.

PGK1 antibody was raised using the C terminal of PGK1 corresponding to a region with amino acids ATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR

The Caspase 6 antibody is a highly specialized affinity ligand that belongs to the class of polyclonal antibodies. It is specifically designed for the isolation and detection of retinal caspase 6, an important enzyme involved in programmed cell death. This antibody is commonly used in life sciences research, particularly in studies related to apoptosis and cell death pathways. It can be used as a powerful tool for investigating caspase 6 inhibitors, nuclear intermediates, and potential therapeutic medicines. The Caspase 6 antibody has been extensively tested and validated for its specificity and sensitivity, making it a reliable choice for researchers working with caspase 6-related studies. Whether you are conducting experiments or developing diagnostic tests, this antibody will provide accurate and reproducible results. With its high-quality formulation and solubilized format, it offers ease of use and convenience in various applications. Trust the Caspase 6 antibody to enhance your research capabilities and advance your scientific discoveries.

The IKB alpha antibody is a highly specialized monoclonal antibody that targets and binds to the inhibitor of kappa B alpha (IKBα) protein. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It is widely used in research laboratories for the detection and analysis of IKBα in different biological samples.