Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75448 products of "Primary Antibodies"
AChE antibody
The AChE antibody is a highly specific antibody used in life sciences research. It can be either a polyclonal antibody or a monoclonal antibody, depending on the specific application. This antibody is designed to target and bind to acetylcholinesterase (AChE), an enzyme responsible for the breakdown of acetylcholine.
NIT2 antibody
NIT2 antibody was raised using the middle region of NIT2 corresponding to a region with amino acids VAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVP
NSE antibody
The NSE antibody is a powerful tool in the field of Life Sciences. It is a growth factor that neutralizes cytotoxic effects and chemokines in various biological processes. This antibody specifically targets TGF-beta, a protein known for its role in cell growth and differentiation. The NSE antibody can be used in research and diagnostic applications to detect and measure the levels of TGF-beta in samples. Additionally, it has been used as a therapeutic agent, particularly in the treatment of collagen-related diseases and as an inhibitor of anti-ACTH antibodies. Its versatility makes it an essential component for scientists studying various cellular processes and diseases, including Mycoplasma genitalium infections. Trust the NSE antibody to provide accurate and reliable results for your research needs.
LGI4 antibody
LGI4 antibody was raised in Rat using Mouse Lgi4 peptide coupled to carrier protein as the immunogen.Caspase 8 antibody
The Caspase 8 antibody is a polyclonal antibody used in life sciences. It specifically targets caspase 8, a cysteine-rich protein that plays a crucial role in apoptosis (programmed cell death). This glycoprotein is an important regulator of cell survival and death pathways. The Caspase 8 antibody can be used for various applications, including western blotting, immunohistochemistry, and flow cytometry.
MHC class II antibody
The MHC class II antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets the antigen binding domain of MHC class II molecules, which play a crucial role in immune response regulation. By binding to these molecules, the antibody can modulate their activity and impact various biological processes.
