Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75448 products of "Primary Antibodies"
CLIC6 antibody
CLIC6 antibody was raised using the middle region of CLIC6 corresponding to a region with amino acids RREDGEASEPRALGQEHDITLFVKAGYDGESIGNCPFSQRLFMILWLKGV
CD8 antibody (Spectral Red)
CD8 antibody (Spectral Red) was raised in mouse using human CD8 as the immunogen.
ARPC2 antibody
The ARPC2 antibody is a growth factor that plays a crucial role in various cellular processes. It is a monoclonal antibody specifically designed to target and neutralize anti-dnp antibodies. The ARPC2 antibody has been extensively studied and proven effective in laboratory experiments using electrodes. Additionally, it has shown promising results in combination therapy with other antibodies such as trastuzumab, targeting the epidermal growth factor receptor.
POU2F2 antibody
The POU2F2 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the chemokine POU2F2 and can be used for various applications such as immunohistochemistry and Western blotting. This antibody has been shown to neutralize the activity of POU2F2, preventing its interaction with other molecules and inhibiting its function. Additionally, it can be used as a cross-linking agent in experiments involving colloidal antigen-antibody complexes. The POU2F2 antibody has high affinity and specificity, allowing for accurate detection and analysis of POU2F2 in samples. Its activated form has been shown to effectively lyse cells expressing high levels of tumor necrosis factor-alpha (TNF-α) receptors, making it a valuable tool for studying TNF-α signaling pathways.
KIAA0859 antibody
KIAA0859 antibody was raised using the C terminal of KIAA0859 corresponding to a region with amino acids NEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTV
CD25 antibody (PE-CY7)
CD25 antibody (PE) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell clone HT-2 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/mol
