Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
TPK1 antibody
TPK1 antibody was raised using the N terminal of TPK1 corresponding to a region with amino acids WNKALLRACADGGANRLYDITEGERESFLPEFINGDFDSIRPEVREYYAT
CATSPER2 antibody
CATSPER2 antibody was raised using the N terminal of CATSPER2 corresponding to a region with amino acids HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA
Collagen 2 antibody
The Collagen 2 antibody is a highly specific monoclonal antibody that targets collagen, an essential protein found in connective tissues. This antibody is derived from human serum and has been extensively studied in the field of Life Sciences. It has shown to be effective in detecting collagen in various research applications.
Annexin A2 antibody
The Annexin A2 antibody is a highly specific monoclonal antibody that targets the Annexin A2 protein. This antibody is commonly used in Life Sciences research and diagnostics. Annexin A2 is an acidic protein that plays a crucial role in various cellular processes, including cell growth, differentiation, and apoptosis. It has been shown to interact with epidermal growth factor (EGF) and act as a co-receptor for EGF receptor signaling.
PIK3R2 antibody
The PIK3R2 antibody is a highly specialized growth factor antibody used in the field of Life Sciences. It belongs to the category of polyclonal antibodies, which are known for their high specificity and sensitivity. This antibody specifically targets the PIK3R2 protein, which plays a crucial role in various cellular processes.
P2X3 antibody
The P2X3 antibody is a monoclonal antibody that has antiestrogen properties. It specifically targets the P2X3 receptor, which is found in adipose tissue and plays a role in various physiological processes. This antibody has been shown to neutralize the activity of the P2X3 receptor, reducing its binding to ligands such as interleukin-6 and natriuretic peptides. By doing so, it can modulate the viscosity of adipose tissue and potentially impact adipocyte function. The P2X3 antibody is also being investigated as a potential therapeutic agent for conditions such as obesity and metabolic disorders. In addition, this antibody can be used in immunoassays for research purposes in the field of life sciences.
OAZ2 antibody
OAZ2 antibody was raised using the middle region of OAZ2 corresponding to a region with amino acids PDGLLADGSKEGLLALLEFAEEKMKVNYVFICFRKGREDRAPLLKTFSFL
Myoglobin antibody
Myoglobin antibody was raised in goat using Human Myoglobin (cardiac) as the immunogen.
