Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
GHR antibody
The GHR antibody is a highly specialized monoclonal antibody that targets the hydrogen atom in natural compounds. It is designed to specifically bind to the dpp4 enzyme, inhibiting its activity and preventing the breakdown of certain hormones. This antibody is commonly used in life sciences research to study the role of dpp4 in various biological processes, including adipose tissue metabolism and hepatocyte growth. Additionally, this antibody can be utilized as a selectable marker in polymerase chain reaction (PCR) experiments or interferon assays. With its high affinity and specificity, the GHR antibody is an invaluable tool for scientists and researchers in the field of molecular biology.
ETFA antibody
ETFA antibody was raised using a synthetic peptide corresponding to a region with amino acids VVSGGRGLKSGENFKLLYDLADQLHAAVGASRAAVDAGFVPNDMQVGQTG
TEX14 antibody
The TEX14 antibody is a protein that acts as a growth factor, specifically targeting epidermal growth factor and hepatocyte growth inhibitory factor. It is an essential component in the field of Life Sciences and is widely used in research studies. The TEX14 antibody can be utilized as both a monoclonal and polyclonal antibody, making it versatile for various applications. Its high specificity allows for accurate detection and analysis of c-myc expression levels. Additionally, the TEX14 antibody has been found to be effective in detecting autoantibodies, making it valuable in diagnostic testing. With its robust capabilities, this antibody is an indispensable tool for researchers in the field.
AFP antibody
AFP antibody was raised in mouse using purified human alpha-fetoprotein as the immunogen.
IBA1 antibody
The IBA1 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to the ionized calcium-binding adapter molecule 1 (IBA1) protein, which is primarily expressed in mouse peritoneal macrophages. This antibody is commonly used for immunohistochemistry and immunofluorescence experiments to visualize and study the activation and behavior of macrophages in various tissues.
TRPA1 antibody
The TRPA1 antibody is a highly specialized antibody used in Life Sciences research. It is designed to specifically target and bind to the TRPA1 protein, which plays a crucial role in various physiological processes. This antibody has been extensively tested and validated for use in techniques such as immunohistochemistry, Western blotting, and immunofluorescence.
PNPase antibody
The PNPase antibody is a highly specialized chemokine antibody that possesses antiviral and anti-mesothelin properties. It is widely used in the field of Life Sciences for various research purposes. This monoclonal antibody specifically targets CD33, a protein expressed on the surface of certain cells, and can be used to study its functions and interactions. The PNPase antibody has also been utilized in electrode development, fibrinogen analysis, growth factor studies, and detection of specific proteins in human serum such as alpha-fetoprotein. Its versatility makes it an invaluable tool for researchers in need of high-quality antibodies and binding proteins. Additionally, this antibody can serve as an inhibitor for specific biological processes when used in appropriate experimental settings.
CDK2 antibody
The CDK2 antibody is a monoclonal antibody that specifically targets the cyclin-dependent kinase 2 (CDK2) protein. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications. It has been found to be effective in inhibiting the growth of hepatocyte, promoting natriuretic activity, and regulating fibrinogen activation. The CDK2 antibody is also known for its histidine glycosylation properties, which enhance its stability and binding affinity. Additionally, this antibody has been used in the detection and quantification of autoantibodies and steroids. With its high specificity and reliability, the CDK2 antibody is a valuable tool for researchers in need of accurate and precise measurements in their studies.
TMEM59L antibody
TMEM59L antibody was raised using the N terminal of TMEM59L corresponding to a region with amino acids PAASAPSARDPFAPQLGDTQNCQLRCRDRDLGPQPSQAGLEGASESPYDR
RGS4 antibody
The RGS4 antibody is a polyclonal antibody that targets the growth factor receptor. It specifically binds to the activated form of epidermal growth factor (EGF) and inhibits its signaling pathway. This antibody has been widely used in life sciences research to study the role of EGF in various cellular processes, including cell proliferation, migration, and differentiation. Additionally, the RGS4 antibody has shown cytotoxic effects on cancer cells expressing high levels of c-myc and HER2/neu receptors. It can be used in combination with other antibodies such as trastuzumab to enhance their efficacy. The high viscosity of this antibody solution allows for easy handling and ensures consistent results. Overall, the RGS4 antibody is a valuable tool for researchers studying growth factor signaling pathways and their role in disease progression.
CD45 antibody
The CD45 antibody is a growth factor that plays a crucial role in various biological processes. It is a glycoprotein with sugar moieties and contains domains similar to epidermal growth factor (EGF) and transforming growth factor-beta (TGF-beta). This antibody has been extensively studied in the field of Life Sciences and has shown promising results.
