Primary Antibodies

NR5A1 antibody was raised using the middle region of NR5A1 corresponding to a region with amino acids SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA

Rabbit polyclonal 14-3-3 alpha/beta antibody (FITC)

ANXA8L2 antibody was raised in Rabbit using Human ANXA8L2 as the immunogen

Calmodulin antibody was raised in mouse using calmodulin purified from Dictyostelium discoideum as the immunogen.

The FUS antibody is a polyclonal antibody that specifically targets the FUS protein. It recognizes the glycan structure present on the FUS protein and has neutralizing properties, making it an effective tool for studying the function of this protein. The FUS antibody can be used in various applications, including Western blotting, immunohistochemistry, and immunofluorescence. It has been shown to have neuroprotective effects and can be used as a therapeutic agent in neurodegenerative diseases. Additionally, the FUS antibody can be used to study glycosylation processes and investigate the role of glycopeptides in cellular functions. In life sciences research, this antibody is widely used as an anti-connexin agent due to its ability to disrupt gap junctions between cells. Furthermore, it has been found to interact with collagen, suggesting potential applications in tissue engineering and regenerative medicine.

The p73 antibody is an essential tool in the field of life sciences. It specifically targets the epidermal growth factor and acts as an endonuclease, which is crucial for DNA repair and maintenance. The p73 antibody is available in both polyclonal and monoclonal forms, providing researchers with options based on their specific needs.

EPS8L1 antibody was raised using the N terminal of EPS8L1 corresponding to a region with amino acids QRDRSPAAETPPLQRRPSVRAVISTVERGAGRGRPQAKPIPEAEEAQRPE

The p53 antibody is a highly specialized cytotoxic antibody that plays a crucial role in regulating cell growth and preventing tumor formation. It is known for its ability to target and neutralize antiphospholipid antibodies, which can lead to autoimmune disorders. Additionally, the p53 antibody has been shown to inhibit the activity of tyrosinase, an enzyme involved in melanin production, making it a potential treatment option for hyperpigmentation disorders.

CD45R antibody (PE) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.

RPL39 antibody was raised in rabbit using the N terminal of RPL39 as the immunogen

The LTBR antibody is a highly effective tool in the field of Life Sciences. It specifically targets and inhibits the activity of glycoproteins involved in various cellular processes. This polyclonal antibody has been extensively studied and shown to have potent cytotoxic effects on activated cells. Additionally, it has been found to interfere with the p38 mitogen-activated protein kinase (MAPK) pathway, a key signaling pathway involved in cell proliferation and survival.

ABHD7 antibody was raised using the N terminal of ABHD7 corresponding to a region with amino acids HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEY

Rat monoclonal NGAL antibody (Biotin)

The MHC class II antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets the antigen binding domain of MHC class II molecules, which play a crucial role in immune response regulation. By binding to these molecules, the antibody can modulate their activity and impact various biological processes.

Rabbit polyclonal Cystatin C antibody (biotin)

Rabbit polyclonal Collagen I alpha 2 antibody

Human IgM antibody (Poly-HRP) was raised in mouse using human IgM as the immunogen.

Cytokeratin 17 antibody was raised in mouse using human cytokeratin 17 as the immunogen.

ADAM19 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRET