CymitQuimica logo
Primary Antibodies

Primary Antibodies

Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.

Subcategories of "Primary Antibodies"

Show 1 more subcategories

Found 75447 products of "Primary Antibodies"

Sort by

Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
products per page.
  • ANKRA2 antibody


    ANKRA2 antibody was raised in rabbit using the C terminal of ANKRA2 as the immunogen

    Purity:Min. 95%

    Ref: 3D-70R-8966

    100µl
    Discontinued
    Discontinued product
  • Metaxin 2 antibody


    Metaxin 2 antibody was raised using the N terminal of MTX2 corresponding to a region with amino acids YIAAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCRA

    Ref: 3D-70R-2450

    100µl
    Discontinued
    Discontinued product
  • vacA antibody


    The vacA antibody is a glycoprotein that plays a crucial role in various biological processes. It exhibits phosphatase and tyrosinase activity, which are essential for cellular functions. This cytotoxic antibody binds to specific proteins and antigens, enabling targeted interactions in the body. In human serum, the vacA antibody has been shown to modulate melanogenesis, the process of pigment production in the skin. Its glycopeptide structure allows for effective antigen-antibody reactions, making it an ideal tool for research and diagnostic purposes. Whether you need a monoclonal or polyclonal antibody, our high-quality vacA antibodies are produced using state-of-the-art hybridoma cell technology. Trust our expertise in Life Sciences to provide you with reliable and accurate results for your scientific endeavors.
    Purity:Min. 95%

    Ref: 3D-70R-51954

    1u
    Discontinued
    100µg
    Discontinued
    Discontinued product
  • USP33 antibody


    USP33 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

    Purity:Min. 95%

    Ref: 3D-20R-UR011

    1u
    Discontinued
    50µg
    Discontinued
    Discontinued product
  • Donkey anti Sheep IgG (H + L) (FITC)


    Donkey anti-sheep IgG (H + L) (FITC) was raised in donkey using sheep IgG (H&L) as the immunogen.

    Ref: 3D-43R-ID031FT

    500µg
    Discontinued
    Discontinued product
  • KIF5B antibody


    KIF5B antibody was raised using the C terminal of KIF5B corresponding to a region with amino acids ANEVKQAVEQQIQSHRETHQKQISSLRDEVEAKAKLITDLQDQNQKMMLE

    Purity:Min. 95%

    Ref: 3D-70R-5541

    100µl
    Discontinued
    Discontinued product
  • Annexin A3 antibody


    The Annexin A3 antibody is an essential antibody-drug that plays a crucial role in various biological processes. It specifically targets and binds to Annexin A3, a protein involved in glucagon receptor binding and antigen presentation. This antibody is available in both polyclonal and monoclonal forms, offering versatility for different research applications.

    Ref: 3D-70R-14049

    100µg
    Discontinued
    Discontinued product
  • GPRC5B antibody


    The GPRC5B antibody is a highly specialized protease that plays a crucial role in the field of Life Sciences. It is a monoclonal antibody that specifically targets and interacts with the GPRC5B antigen, which is involved in various biological processes. This antibody has been extensively studied for its potential applications in antiviral therapies, high-flux extracellular chemotherapy, and as an inhibitor in certain disease pathways. The GPRC5B antibody is widely recognized for its exceptional specificity and sensitivity, making it an invaluable tool for researchers and scientists working in the field of antibodies and autoantibodies.

    Ref: 3D-70R-30935

    100µg
    Discontinued
    Discontinued product
  • GATA1 antibody


    The GATA1 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets GATA1, a transcription factor involved in the regulation of gene expression. This antibody can be used to study various cellular processes, including cell differentiation, proliferation, and apoptosis. The GATA1 antibody has been shown to have cytotoxic effects on certain cancer cells and can also modulate the production of interferon-gamma (IFN-gamma), an important cytokine involved in immune responses. Additionally, this antibody has been used in research related to β-catenin signaling pathway and growth factors. Whether you are studying antiviral mechanisms or nuclear signaling events, the GATA1 antibody is an essential tool for your research needs.

    Purity:Min. 95%

    Ref: 3D-20R-2225

    50µg
    Discontinued
    Discontinued product
  • CKB antibody


    The CKB antibody is a polyclonal antibody that specifically targets the creatine kinase B (CKB) protein. This antibody is widely used in Life Sciences research to study various cellular processes and signaling pathways. The CKB protein plays a crucial role in energy metabolism by catalyzing the reversible transfer of phosphate between ATP and creatine, thus providing a readily available source of energy for cells. It is primarily expressed in tissues with high-energy demands, such as skeletal muscle, heart, and brain.

    Ref: 3D-70R-33146

    100µl
    Discontinued
    Discontinued product
  • CaMK2 alpha/beta/theta antibody


    Rabbit polyclonal CaMK2 alpha/beta/theta antibody

    Ref: 3D-70R-30563

    100µg
    Discontinued
    Discontinued product
  • HSPA9 antibody


    The HSPA9 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets HSPA9, also known as heat shock 70kDa protein 9. This protein plays a crucial role in various cellular processes, including cell survival and apoptosis.

    Ref: 3D-70R-14326

    100µg
    Discontinued
    Discontinued product
  • EpCAM antibody


    The EpCAM antibody is a monoclonal antibody that specifically targets the Epithelial Cell Adhesion Molecule (EpCAM). It has been widely used in Life Sciences research for various applications. This neutralizing antibody can effectively block the interaction between EpCAM and its ligands, preventing downstream signaling events.

    Ref: 3D-10R-3981

    100µl
    Discontinued
    Discontinued product
  • CAPNS2 antibody


    CAPNS2 antibody was raised in Rabbit using Human CAPNS2 as the immunogen

    Ref: 3D-70R-16159

    50µl
    Discontinued
    Discontinued product
  • CD74 antibody


    The CD74 antibody is a monoclonal antibody commonly used in Life Sciences research. It specifically targets and binds to the CD74 protein, which plays a crucial role in immune responses. This antibody has been shown to inhibit the production of reactive oxygen species and interferon, making it a valuable tool for studying immune system regulation. Additionally, the CD74 antibody can be used to detect autoantibodies and analyze their interactions with cellular components. With its high affinity and specificity, this antibody provides reliable results in various applications such as immunohistochemistry, flow cytometry, and Western blotting. Researchers can trust the CD74 antibody to deliver accurate and reproducible results in their experiments.

    Ref: 3D-70R-13367

    100µl
    Discontinued
    Discontinued product
  • Mouse anti Human Kappa Light Chain antibody


    Human kappa light chain antibody was raised in mouse using a constantly expressed epitope of kappa chain as the immunogen.

    Ref: 3D-10R-K100A

    1mg
    Discontinued
    Discontinued product
  • PMM2 antibody


    Affinity purified Rabbit polyclonal PMM2 antibody

    Ref: 3D-70R-13583

    100µl
    Discontinued
    Discontinued product
  • TNF alpha antibody


    TNF alpha antibody was raised in goat using highly pure recombinant human TNF-alpha as the immunogen.

    Ref: 3D-20R-TG002

    1u
    Discontinued
    50µg
    Discontinued
    Discontinued product
  • SYT1 antibody


    The SYT1 antibody is a highly effective polyclonal antibody that targets angptl3, a glycoprotein involved in various biological processes. This antibody can be used in chromatographic techniques for protein purification and immobilization, making it an essential tool in life sciences research. Additionally, the SYT1 antibody has neutralizing properties against inhibitors of growth factors, such as collagen, making it a valuable asset in cytotoxic studies. Whether you're conducting experiments or developing therapeutic strategies, the SYT1 antibody is a reliable choice for your research needs.

    Ref: 3D-70R-15065

    ne
    Discontinued
    100µl
    Discontinued
    Discontinued product
  • CD51/61 antibody


    Mouse monoclonal CD51/61 antibody

    Ref: 3D-10R-6418

    100µg
    Discontinued
    Discontinued product