Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
ANKRA2 antibody
ANKRA2 antibody was raised in rabbit using the C terminal of ANKRA2 as the immunogen
Purity:Min. 95%Metaxin 2 antibody
Metaxin 2 antibody was raised using the N terminal of MTX2 corresponding to a region with amino acids YIAAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCRA
vacA antibody
The vacA antibody is a glycoprotein that plays a crucial role in various biological processes. It exhibits phosphatase and tyrosinase activity, which are essential for cellular functions. This cytotoxic antibody binds to specific proteins and antigens, enabling targeted interactions in the body. In human serum, the vacA antibody has been shown to modulate melanogenesis, the process of pigment production in the skin. Its glycopeptide structure allows for effective antigen-antibody reactions, making it an ideal tool for research and diagnostic purposes. Whether you need a monoclonal or polyclonal antibody, our high-quality vacA antibodies are produced using state-of-the-art hybridoma cell technology. Trust our expertise in Life Sciences to provide you with reliable and accurate results for your scientific endeavors.Purity:Min. 95%USP33 antibody
USP33 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%Donkey anti Sheep IgG (H + L) (FITC)
Donkey anti-sheep IgG (H + L) (FITC) was raised in donkey using sheep IgG (H&L) as the immunogen.
KIF5B antibody
KIF5B antibody was raised using the C terminal of KIF5B corresponding to a region with amino acids ANEVKQAVEQQIQSHRETHQKQISSLRDEVEAKAKLITDLQDQNQKMMLE
Purity:Min. 95%Annexin A3 antibody
The Annexin A3 antibody is an essential antibody-drug that plays a crucial role in various biological processes. It specifically targets and binds to Annexin A3, a protein involved in glucagon receptor binding and antigen presentation. This antibody is available in both polyclonal and monoclonal forms, offering versatility for different research applications.
GPRC5B antibody
The GPRC5B antibody is a highly specialized protease that plays a crucial role in the field of Life Sciences. It is a monoclonal antibody that specifically targets and interacts with the GPRC5B antigen, which is involved in various biological processes. This antibody has been extensively studied for its potential applications in antiviral therapies, high-flux extracellular chemotherapy, and as an inhibitor in certain disease pathways. The GPRC5B antibody is widely recognized for its exceptional specificity and sensitivity, making it an invaluable tool for researchers and scientists working in the field of antibodies and autoantibodies.
GATA1 antibody
The GATA1 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets GATA1, a transcription factor involved in the regulation of gene expression. This antibody can be used to study various cellular processes, including cell differentiation, proliferation, and apoptosis. The GATA1 antibody has been shown to have cytotoxic effects on certain cancer cells and can also modulate the production of interferon-gamma (IFN-gamma), an important cytokine involved in immune responses. Additionally, this antibody has been used in research related to β-catenin signaling pathway and growth factors. Whether you are studying antiviral mechanisms or nuclear signaling events, the GATA1 antibody is an essential tool for your research needs.
Purity:Min. 95%CKB antibody
The CKB antibody is a polyclonal antibody that specifically targets the creatine kinase B (CKB) protein. This antibody is widely used in Life Sciences research to study various cellular processes and signaling pathways. The CKB protein plays a crucial role in energy metabolism by catalyzing the reversible transfer of phosphate between ATP and creatine, thus providing a readily available source of energy for cells. It is primarily expressed in tissues with high-energy demands, such as skeletal muscle, heart, and brain.
HSPA9 antibody
The HSPA9 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets HSPA9, also known as heat shock 70kDa protein 9. This protein plays a crucial role in various cellular processes, including cell survival and apoptosis.
EpCAM antibody
The EpCAM antibody is a monoclonal antibody that specifically targets the Epithelial Cell Adhesion Molecule (EpCAM). It has been widely used in Life Sciences research for various applications. This neutralizing antibody can effectively block the interaction between EpCAM and its ligands, preventing downstream signaling events.
CD74 antibody
The CD74 antibody is a monoclonal antibody commonly used in Life Sciences research. It specifically targets and binds to the CD74 protein, which plays a crucial role in immune responses. This antibody has been shown to inhibit the production of reactive oxygen species and interferon, making it a valuable tool for studying immune system regulation. Additionally, the CD74 antibody can be used to detect autoantibodies and analyze their interactions with cellular components. With its high affinity and specificity, this antibody provides reliable results in various applications such as immunohistochemistry, flow cytometry, and Western blotting. Researchers can trust the CD74 antibody to deliver accurate and reproducible results in their experiments.
Mouse anti Human Kappa Light Chain antibody
Human kappa light chain antibody was raised in mouse using a constantly expressed epitope of kappa chain as the immunogen.
TNF alpha antibody
TNF alpha antibody was raised in goat using highly pure recombinant human TNF-alpha as the immunogen.SYT1 antibody
The SYT1 antibody is a highly effective polyclonal antibody that targets angptl3, a glycoprotein involved in various biological processes. This antibody can be used in chromatographic techniques for protein purification and immobilization, making it an essential tool in life sciences research. Additionally, the SYT1 antibody has neutralizing properties against inhibitors of growth factors, such as collagen, making it a valuable asset in cytotoxic studies. Whether you're conducting experiments or developing therapeutic strategies, the SYT1 antibody is a reliable choice for your research needs.
