Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
SMYD3 antibody
The SMYD3 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to the SMYD3 protein, which is primarily found in the nucleus of cells. This immobilized antibody can be used for various applications, including research studies and diagnostic purposes.
Aggrecan antibody
The Aggrecan antibody is a highly effective neutralizing agent used in the field of Life Sciences. This antibody is specifically designed to target and inhibit the activity of aggrecan, a growth factor that plays a crucial role in various biological processes. It has been extensively studied for its potential applications in mesenchymal stem cell research, as well as its ability to modulate TGF-beta signaling pathways.
B7H4 antibody
The B7H4 antibody is a highly effective medicament that belongs to the class of monoclonal antibodies. It is widely used in the field of Life Sciences for its remarkable properties. The antibody complex specifically targets and binds to B7H4, a protein expressed on the surface of various cancer cells, including MDA-MB-231 breast cancer cells. This binding inhibits the growth and proliferation of cancer cells by interfering with their signaling pathways.
Protein S antibody
Protein S antibody was raised in sheep using human Protein S purified from plasma as the immunogen.Purity:Min. 95%PCIP antibody
The PCIP antibody is a highly specialized monoclonal antibody that targets the fas-mediated apoptosis pathway. It has been extensively studied in adipose tissue and has shown cytotoxic effects on cells expressing high levels of interleukin-6 (IL-6) and growth factor receptors. This monoclonal antibody specifically binds to β-catenin, a key protein involved in cell signaling and regulation of gene expression. It has also been shown to interact with other monoclonal antibodies targeting collagen, erythropoietin, fibrinogen, and phosphatase. The PCIP antibody disrupts the organization of actin filaments within cells, leading to apoptosis and inhibition of cell growth.
ATP6V0D2 antibody
ATP6V0D2 antibody was raised using the middle region of ATP6V0D2 corresponding to a region with amino acids GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM
D-dimer antibody
D-dimer antibody is a monoclonal antibody that specifically targets D-dimer, a protein fragment that is produced when blood clots are broken down. This antibody has antiviral properties and can neutralize the activity of D-dimer, preventing excessive blood clot formation. In addition to its therapeutic use, this antibody is also used in research and diagnostics in the field of Life Sciences. It can be used to study the role of D-dimer in various biological processes, such as wound healing and thrombosis. The formulation of this antibody includes excipients like histidine and insulin to ensure stability and enhance its efficacy.MYH10 antibody
MYH10 antibody was raised using the N terminal of MYH10 corresponding to a region with amino acids WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKAD
CHRNB3 antibody
CHRNB3 antibody was raised in rabbit using the middle region of CHRNB3 as the immunogen
WDR8 antibody
WDR8 antibody was raised using the middle region of WDR8 corresponding to a region with amino acids GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML
Goat anti Rabbit IgG (H + L) (FITC)
Goat anti-rabbit IgG (H + L) (FITC) was raised in goat using rabbit IgG, (H&L) as the immunogen.
ATM antibody
The ATM antibody is a highly specialized monoclonal antibody that has been designed to target and bind to the ATM protein. This protein plays a crucial role in the DNA damage response pathway and is involved in cell cycle regulation, DNA repair, and apoptosis. The ATM antibody can be used in various research applications, including molecular docking studies, immunoassays, and hybridization experiments. It has been shown to specifically recognize and form a complex with the epidermal growth factor (EGF)-like domain of the ATM protein. Additionally, the ATM antibody exhibits high affinity for albumin, a major component of human serum. Its unique binding properties make it an invaluable tool for scientists working in the field of life sciences who are studying cellular processes related to DNA damage and repair.
