Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,793 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75326 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
ST14 antibody
<p>ST14 antibody is a monoclonal antibody that targets protein kinase ST14. It is widely used in Life Sciences research for its ability to specifically bind to ST14 and inhibit its activity. This antibody has been shown to effectively block the function of ST14, preventing its interaction with other proteins and interfering with various cellular processes. Additionally, ST14 antibody has been used in studies involving albumin, inhibitors, antibodies, tyrosine, alpha-synuclein, activated mitogen-activated protein (MAP) kinases, collagen, and glucose transporter. It is also known to enhance the cytotoxic effects of certain anti-CD20 antibodies. With its high specificity and potency, ST14 antibody is a valuable tool for scientists studying protein kinase signaling pathways and their role in disease development and progression.</p>Rabbit anti Rat IgG (H + L) (FITC)
<p>Rabbit anti-rat IgG (H+L) (FITC) was raised in rabbit using rat IgG whole molecule as the immunogen.</p>Purity:Min. 95%HHEX antibody
<p>HHEX antibody was raised in mouse using recombinant Homeobox, Hematopoietically Expressed</p>Morf4l1 antibody
<p>Morf4l1 antibody was raised in rabbit using the middle region of Morf4l1 as the immunogen</p>Purity:Min. 95%N cadherin antibody
<p>The N cadherin antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes such as cell adhesion, differentiation, and migration. This antibody specifically targets N cadherin, a protein that is involved in cell-cell adhesion and signaling.</p>RBM4 antibody
<p>RBM4 antibody was raised using the C terminal of RBM4 corresponding to a region with amino acids LQQQPLLLLLQLPLHITGGIGAPCVALQPQSPLLERATVTGMRVSCPKLQ</p>STAT3 antibody
<p>The STAT3 antibody is a peptide antigen used in Life Sciences research. It is commonly used in studies involving the expression plasmid and antibodies. This antibody specifically targets the inhibitory factor of the cytokine family, interleukin-6, and has been shown to inhibit the activation of reactive glial fibrillary acidic cells. The STAT3 antibody can be used in various experimental techniques, such as immunohistochemistry and Western blotting. Its high specificity and affinity make it an ideal tool for researchers studying cell signaling pathways and inflammatory responses. With its wide range of applications, this polyclonal antibody is a valuable asset for any laboratory or research facility.</p>ZNF707 antibody
<p>ZNF707 antibody was raised in rabbit using the N terminal of ZNF707 as the immunogen</p>Purity:Min. 95%Fibronectin antibody
<p>The Fibronectin antibody is a monoclonal antibody that specifically targets fibronectin, a glycoprotein found in the extracellular matrix. Fibronectin plays a crucial role in cell adhesion, migration, and tissue repair. This antibody can be used for various applications, including research and diagnostic purposes.</p>ASK1 antibody
<p>The ASK1 antibody is a powerful medicinal composition that acts as an inhibitor of the signal-regulating kinase known as ASK1. This antibody has been extensively studied in the field of Life Sciences and has shown promising results as a potential therapeutic agent for various diseases. By inhibiting the activity of ASK1, this antibody blocks intracellular ATP and reduces pro-inflammatory activity, making it a valuable tool in the development of anti-inflammatory drugs. Additionally, the ASK1 antibody has been used in assays to study integrin binding and its role in cell signaling pathways. With its versatility and potential applications, this polyclonal antibody holds great promise as a research tool and may even have future implications in the development of anticancer agents.</p>GAB2 antibody
<p>The GAB2 antibody is a highly specialized product used in the field of Life Sciences. It plays a crucial role in various biological processes, including cation channel regulation and antigen-antibody reactions. This antibody specifically targets the activated form of platelet fibrinogen, which is essential for blood clotting.</p>
