Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,793 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75326 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
FGFR1 antibody
<p>The FGFR1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and inhibits the growth factor receptor FGFR1, which plays a crucial role in cell growth and proliferation. By blocking the activation of FGFR1, this antibody prevents the downstream signaling pathways that promote cell division.</p>Purity:Min. 95%AKR1C2 antibody
<p>AKR1C2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSK</p>NF kappaB p65 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp techniques on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>Morf4l1 antibody
<p>Morf4l1 antibody was raised in rabbit using the middle region of Morf4l1 as the immunogen</p>Purity:Min. 95%HHEX antibody
<p>HHEX antibody was raised in mouse using recombinant Homeobox, Hematopoietically Expressed</p>TM7SF4 antibody
<p>TM7SF4 antibody was raised in rabbit using the N terminal of TM7SF4 as the immunogen</p>Purity:Min. 95%Fibronectin antibody
<p>The Fibronectin antibody is a monoclonal antibody that specifically targets fibronectin, a glycoprotein found in the extracellular matrix. Fibronectin plays a crucial role in cell adhesion, migration, and tissue repair. This antibody can be used for various applications, including research and diagnostic purposes.</p>CLEC4G antibody
<p>CLEC4G antibody was raised using the N terminal of CLEC4G corresponding to a region with amino acids RTNASKQTAALGALKEEVGDCHSCCSGTQAQLQTTRAELGEAQAKLMEQE</p>Purity:Min. 95%Protein C antibody
<p>Protein C antibody was raised using a synthetic peptide corresponding to a region with amino acids PCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLD</p>Purity:Min. 95%anti-Chicken IBDV Antibody Monoclonal
<p>Infectious bronchitis virus (IBVD) is an acute, highly contagious upper respiratory tract disease in chickens</p>Purity:Min. 95%Goat anti Human IgG (Texas Red)
<p>Goat anti-human IgG was raised in goat using human IgG F(c) fragment as the immunogen.</p>Purity:Min. 95%
