Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,709 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(738 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75327 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
IPPK antibody
<p>IPPK antibody was raised using the middle region of IPPK corresponding to a region with amino acids KTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQIDGPYDEAFYQK</p>ERBB2 antibody
<p>The ERBB2 antibody is a neutralizing monoclonal antibody that specifically targets the ERBB2 protein. This glycoprotein is known to play a crucial role in cell growth and division. By binding to the ERBB2 receptor, this antibody inhibits the activation of downstream signaling pathways, thereby preventing the proliferation of cancer cells.</p>TRIM5 alpha antibody
<p>TRIM5 alpha antibody was raised in Mouse using a purified recombinant fragment of human TRIM5 alpha expressed in E. coli as the immunogen.</p>C5ORF39 antibody
<p>C5ORF39 antibody was raised using the N terminal Of C5Orf39 corresponding to a region with amino acids EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS</p>CBL antibody
<p>The CBL antibody is a highly effective inhibitor that targets nuclear chemokine receptors. This monoclonal antibody has neutralizing properties, making it an ideal choice for blocking the activity of acetylcholine and other autoantibodies. Additionally, the CBL antibody has antiangiogenic effects, making it a valuable tool in the field of Life Sciences.</p>Karyopherin Alpha 1 antibody
<p>Karyopherin Alpha 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVA</p>STAT6 antibody
<p>The STAT6 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to the STAT6 protein, which is involved in various cellular processes. This antibody has been shown to be effective in neutralizing the activity of activated STAT6, preventing its interaction with other proteins and inhibiting downstream signaling pathways. Additionally, the STAT6 antibody has been found to inhibit the binding of fibrinogen and chemokines, thereby reducing inflammation. It also shows potential as an anti-mesothelin antibody, targeting a protein often overexpressed in certain cancers. Furthermore, this antibody has demonstrated antiviral activity by blocking viral entry into cells. Its ability to neutralize growth factors makes it a valuable tool for studying cell proliferation and differentiation processes. In summary, the STAT6 antibody is a versatile research tool with diverse applications in various fields of study within the Life Sciences domain.</p>Purity:Min. 95%CCT8 antibody
<p>CCT8 antibody was raised using a synthetic peptide corresponding to a region with amino acids DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK</p>PDE7B antibody
<p>PDE7B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Purity:Min. 95%
