Primary Antibodies

<p>NUDT22 antibody was raised in rabbit using the C terminal of NUDT22 as the immunogen</p>

<p>ZNF317 antibody was raised in rabbit using the C terminal of ZNF317 as the immunogen</p>

<p>MAFK antibody was raised in rabbit using the N terminal of MAFK as the immunogen</p>

<p>The TDG antibody is a highly specific monoclonal antibody that targets the glycan structures on glycoproteins. It is widely used in life sciences research to study the role of glycans in various biological processes. The TDG antibody can be used for applications such as lectin blotting, glycan profiling, and immunohistochemistry. This antibody recognizes a polymorphic epitope that is activated by fatty acid treatment, making it a valuable tool for studying changes in glycosylation patterns. Additionally, the TDG antibody has been shown to interact with epithelial cadherin, suggesting a potential role in cell adhesion and signaling pathways. With its high specificity and sensitivity, this monoclonal antibody is an essential tool for researchers studying glycan-related processes in human proteins.</p>

<p>Rabbit polyclonal PFDN4 antibody</p>

<p>The NFKB p65 antibody is a glycoprotein that belongs to the class of chemokines. It plays a crucial role in regulating immune responses and inflammation. This monoclonal antibody specifically targets the p65 subunit of the nuclear factor kappa B (NFKB) complex, which is involved in the transcriptional regulation of numerous genes associated with immune and inflammatory responses.</p>

<p>ZBTB6 antibody was raised in rabbit using the N terminal of ZBTB6 as the immunogen</p>

<p>Rabbit polyclonal MDR1 antibody (HRP)</p>

<p>The Uromodulin antibody is a highly specialized biotinylated antibody that is used in various research applications in the field of Life Sciences. This antibody specifically targets and binds to uromodulin, a protein found in high concentrations in human hepatocytes. The Uromodulin antibody has been extensively characterized and validated for its specificity and sensitivity.</p>

<p>NOSIP antibody was raised in rabbit using the middle region of NOSIP as the immunogen</p>

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>Rabbit polyclonal PDGFR alpha antibody (Tyr754)</p>

<p>The MTHFR antibody is a powerful tool used in various immunoassays and research applications. It specifically targets the methylenetetrahydrofolate reductase (MTHFR) enzyme, which plays a crucial role in dopamine metabolism and cytochrome P450 oxidoreductase activity. This monoclonal antibody is derived from a hybridoma cell line and exhibits high specificity and affinity for MTHFR.</p>

<p>Purified Rabbit polyclonal OSGEPL1 antibody</p>

<p>The PDK1 antibody is a monoclonal antibody that has been developed for use in the field of Life Sciences. It specifically targets alpha-fetoprotein, a protein that is expressed in various tissues including cardiomyocytes. The PDK1 antibody has been shown to have neutralizing effects on chemokines, which play a crucial role in inflammation and immune response. This antibody can be used as a research tool to study the function and regulation of chemokines in different biological processes. Additionally, the PDK1 antibody has been found to inhibit the activity of β-catenin, an important signaling molecule involved in cell proliferation and differentiation. This inhibition can have implications for cancer research and therapeutics development. The PDK1 antibody is produced using advanced techniques in monoclonal antibody production and undergoes rigorous quality control to ensure its efficacy and specificity. It is formulated with excipients that maintain its stability and functionality.</p>

<p>Purified Rabbit polyclonal eEF1 alpha antibody</p>

<p>HEF1/NEDD-9 Monoclonal Antibody</p>

<p>Carboxypeptidase B2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI</p>

<p>The Ataxin 2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to annexin, a protein involved in various cellular processes. This buffered monoclonal antibody has been extensively tested and validated for its efficacy and specificity.</p>

<p>MDH1B antibody was raised using a synthetic peptide corresponding to a region with amino acids YQSGHKDLVPDEEKNLAMSDAAEFPNQIPQTTFEKPQSLEFLNEFEGKTV</p>