Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,757 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75327 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
BIKE antibody
<p>The BIKE antibody is a monoclonal antibody that has the ability to neutralize and react with specific targets in adipose tissue. This antibody is commonly used in Life Sciences research for the detection and immobilization of activated nuclear β-catenin. It can be used in various applications, such as electrochemical impedance spectroscopy, where it plays a crucial role in detecting and measuring changes in electrical properties. The BIKE antibody is highly specific and can bind to its target with high affinity, making it an essential tool for researchers working in the field of molecular biology. Whether you're studying protein-protein interactions or analyzing cellular signaling pathways, this monoclonal antibody is a valuable asset to have in your toolkit.</p>EPHX1 antibody
<p>EPHX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLI</p>Purity:Min. 95%FATE1 antibody
<p>FATE1 antibody was raised in rabbit using the N terminal of FATE1 as the immunogen</p>Purity:Min. 95%MST1 antibody
<p>MST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLE</p>Purity:Min. 95%PKD2 antibody
<p>PKD2 antibody was raised in rabbit using human PKD2 protein as the immunogen.</p>Purity:Min. 95%ZNF75A antibody
<p>ZNF75A antibody was raised in rabbit using the N terminal of ZNF75A as the immunogen</p>Purity:Min. 95%C18ORF25 antibody
<p>C18ORF25 antibody was raised using the middle region of C18Orf25 corresponding to a region with amino acids STSSSDDDEEVSGSSKTITAEIPGHLDPGFLASDKTSAGNAPLNEEINIA</p>Cadherin 6 antibody
<p>The Cadherin 6 antibody is a monoclonal antibody that specifically targets the plasminogen receptor. It is commonly used in life sciences research for various applications. This antibody has high affinity and specificity for its target, making it an ideal tool for studying the function of Cadherin 6.</p>TRAIL Receptor 4 antibody
<p>TRAIL receptor 4 antibody was raised in rabbit using N terminus of the mature human TRAIL-R4 protein as the immunogen.</p>Purity:Min. 95%DNM1L antibody
<p>DNM1L antibody was raised in rabbit using the N terminal of DNM1L as the immunogen</p>Purity:Min. 95%CEA antibody
<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>Rod1 antibody
<p>Rod1 antibody was raised in rabbit using the N terminal of Rod1 as the immunogen</p>Purity:Min. 95%MTHFS antibody
<p>MTHFS antibody was raised using a synthetic peptide corresponding to a region with amino acids TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAY</p>
