Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
MEK1 antibody
The MEK1 antibody is a glycopeptide that targets the growth factor receptor, specifically designed for use in Life Sciences research. This polyclonal antibody has been extensively tested and validated for its high specificity and sensitivity in detecting MEK1 protein. It can be used in various applications such as Western blotting, immunohistochemistry, and immunofluorescence.
Trazodone antibody
The Trazodone antibody is a reactive monoclonal antibody that falls under the category of Life Sciences. It is specifically designed to target and neutralize tumor necrosis factor-alpha (TNF-α) and interleukin (IL), which are key inflammatory factors in the body. This antibody has shown inhibitory effects on adipose tissue and chemokine production, making it a potential therapeutic option for conditions associated with inflammation and immune dysregulation. Additionally, the Trazodone antibody has been found to have neutralizing activity against Brucella abortus, a bacterium that causes brucellosis in animals and humans. This suggests its potential use in treating infections caused by this pathogen. Furthermore, this antibody exhibits inhibitory effects on family kinase inhibitors and calmodulin, which are involved in various cellular processes such as signal transduction and calcium signaling. By targeting these proteins, the Trazodone antibody may have implications for the treatment of diseases related to their dysPurity:Min. 95%Mcm7 antibody
The Mcm7 antibody is a cytotoxic monoclonal antibody that belongs to the category of Life Sciences products. It has been specifically designed to target and neutralize the activated form of Mcm7, an inhibitory factor involved in various biological processes. This antibody has been shown to have neuroprotective properties and can inhibit the activity of interleukin-6, a hormone peptide involved in inflammatory responses. Additionally, it has been found to interact with cholinergic receptors and exhibit inhibitory effects on liver microsomes. The Mcm7 antibody is a highly specialized tool for researchers in the field of Life Sciences who are studying the role of Mcm7 in cellular processes and its potential as a therapeutic target.
CYP1A1 antibody
The CYP1A1 antibody is a highly specific antibody that targets the cytochrome P450 1A1 enzyme. This enzyme plays a crucial role in the metabolism of various drugs and toxins in the body. The CYP1A1 antibody can be used in various research applications, including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assay (ELISA). It has been extensively validated for its specificity and sensitivity.
IL15Ra antibody
The IL15Ra antibody is a highly specialized antibody used in Life Sciences research. It targets the IL-15 receptor alpha chain, which plays a crucial role in immune response and cell proliferation. This antibody is commonly used in studies involving colony-stimulating factors and macrophage colony-stimulating factors.
NPDC1 antibody
NPDC1 antibody was raised using the N terminal of NPDC1 corresponding to a region with amino acids MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCAL
Midkine antibody
The Midkine antibody is a powerful tool in Life Sciences research. Midkine is a growth factor that plays a crucial role in various biological processes, including cell proliferation, migration, and survival. It interacts with TGF-β1 and other binding proteins to regulate the activity of the erythropoietin receptor.
PDIA4 antibody
PDIA4 antibody was raised using the N terminal of PDIA4 corresponding to a region with amino acids ENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLL
Purity:Min. 95%NSE antibody
The NSE antibody is a highly specialized monoclonal antibody that is used in various medical applications. It is commonly used in electrophoresis and high-dose chemotherapy procedures. This antibody specifically targets histone deacetylase inhibitors, which are involved in regulating gene expression and cell growth.
Claudin 11 antibody
Claudin 11 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH
Purity:Min. 95%QTRT1 antibody
QTRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQL
PTBP2 antibody
PTBP2 antibody was raised using the N terminal of PTBP2 corresponding to a region with amino acids MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGE
