Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,709 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(738 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75327 products of "Primary Antibodies"
TPPP3 antibody
TPPP3 antibody was raised using the middle region of TPPP3 corresponding to a region with amino acids PANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDD
TRIM24 antibody
The TRIM24 antibody is a highly effective neutralizing agent that targets actin filaments and fibrinogen in Life Sciences research. It is commonly used in immunoassays to detect and quantify specific proteins of interest. This monoclonal antibody, derived from colloidal gold particles, exhibits high specificity and sensitivity in detecting target molecules. It can be used for various applications including Western blotting, ELISA, immunohistochemistry, and flow cytometry. The TRIM24 antibody has been extensively validated and proven to provide reliable results in research experiments. Its unique properties make it an essential tool for scientists studying protein interactions, signal transduction pathways, and cellular processes. With its exceptional performance, this antibody offers researchers the opportunity to gain valuable insights into the molecular mechanisms underlying various diseases and biological phenomena.
TNNI3K antibody
TNNI3K antibody was raised using the middle region of TNNI3K corresponding to a region with amino acids PGRSHVAALRSRFELEYALNARSYAALSQSAGQYSSQGLSLEEMKRSLQY
Caspase 1 antibody
The Caspase 1 antibody is a highly reactive monoclonal antibody that specifically targets caspase 1, an enzyme involved in inflammatory responses and programmed cell death. This antibody is widely used in life sciences research to study the role of caspase 1 in various biological processes, including adipose tissue inflammation, cancer development, and immune response modulation.
EVI1 antibody
EVI1 antibody was raised in mouse using recombinant Human Ecotropic Viral Integration Site 1 (Evi1)
DCK antibody
DCK antibody was raised using the middle region of DCK corresponding to a region with amino acids QLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQD
MTHFD1 antibody
MTHFD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKD
TRIM5 alpha antibody
TRIM5 alpha antibody was raised in Mouse using a purified recombinant fragment of human TRIM5 alpha expressed in E. coli as the immunogen.
CA1 antibody
The CA1 antibody is a highly specific monoclonal antibody that targets nuclear extracts. It is designed to detect and bind to a specific test substance found in mesothelial cells. This activated antibody can be used in various applications, including immunohistochemistry and Western blotting. The CA1 antibody is produced using advanced techniques that ensure high specificity and sensitivity. It is available as both a monoclonal antibody and a peptide conjugate for different research needs. Additionally, polyclonal antibodies are also available for researchers working with pluripotent cells or studying the effects of TGF-β1. The CA1 antibody has been shown to be reactive and neutralizing, making it an essential tool for researchers in the field of molecular biology.
BMX antibody
The BMX antibody is a powerful tool for researchers in the field of molecular biology. It is an antibody that specifically targets and binds to the BMX protein, a member of the tyrosine kinase family. This antibody can be used in various applications, such as Western blotting, immunoprecipitation, and immunofluorescence.
Tau antibody
The Tau antibody is a highly specialized antibody that plays a crucial role in various biological processes. It has the ability to neutralize interferon and collagen, making it an essential component in the field of Life Sciences. This antibody is available both as polyclonal antibodies derived from human serum and as monoclonal antibodies.
SirT1 antibody
The SirT1 antibody is a highly specialized tool used in life sciences research. It is a polyclonal antibody that specifically targets the Sirtuin 1 (SirT1) protein, which plays a crucial role in various cellular processes. This antibody can be used in a wide range of applications, including western blotting, immunohistochemistry, and immunofluorescence.
Granzyme B antibody (PE)
Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.
