Primary Antibodies

<p>SLC46A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids  MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHR</p>

<p>Purified Polyclonal CEP57 antibody</p>

<p>MIP1 alpha antibody was raised in rabbit using highly pure recombinant rat MIP1 alpha as the immunogen.</p>

<p>PLCG2 antibody is an effective substance used in the field of Life Sciences. It is an antibody that specifically targets and interacts with PLCG2, a protein involved in cellular signaling pathways. This antibody can be used for various applications, including interferon assays, detection of recombinant antigens, and testing the expression of PLCG2 in different cell types.</p>

<p>The FGFR1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and inhibits the growth factor receptor FGFR1, which plays a crucial role in cell growth and proliferation. By blocking the activation of FGFR1, this antibody prevents the downstream signaling pathways that promote cell division.</p>

<p>Mouse monoclonal TSH antibody (Prediluted for IHC)</p>

<p>ABCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD</p>

<p>Purified Polyclonal HCCS antibody</p>

<p>C9orf64 antibody was raised in rabbit using the C terminal of C9orf64 as the immunogen</p>

<p>GPR88 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>LPIN2 antibody was raised in Rabbit using Human LPIN2 as the immunogen</p>

<p>PNN antibody was raised using the N terminal of PNN corresponding to a region with amino acids MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGP</p>

<p>KCNA10 antibody was raised using the N terminal of KCNA10 corresponding to a region with amino acids DVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKI</p>

<p>WNT6 antibody was raised using the middle region of WNT6 corresponding to a region with amino acids ERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTG</p>

<p>The TGFBR2 antibody is a polyclonal antibody that specifically targets the transforming growth factor beta receptor 2 (TGFBR2). It is commonly used in research and diagnostic applications to detect and quantify the expression of TGFBR2. This antibody binds to the activated form of TGFBR2, inhibiting its interaction with other proteins involved in signal transduction pathways. Additionally, it has been shown to block the binding of interferon-gamma (IFN-gamma) to TGFBR2, suggesting a potential role in modulating immune responses. The TGFBR2 antibody is available as both monoclonal and polyclonal forms, providing researchers with options for their specific experimental needs. Its high specificity and sensitivity make it a valuable tool for studying the function and regulation of TGFBR2 in various biological systems.</p>

<p>Armenian Hamster monoclonal CD103 antibody (biotin)</p>

<p>The FKBPL antibody is a high-quality polyclonal antibody that is colloidal in nature. It specifically targets the thioredoxin interacting protein (FKBPL) and forms a strong disulfide bond with it. This antibody is widely used in life sciences research for various applications, including the study of reactive growth factors and biomolecules. It can also be used as a drug antibody or diagnostic reagent due to its high specificity and affinity for FKBPL. Additionally, this antibody has shown promising results in collagen-related research and can be used in electrode-based assays. For researchers looking for a reliable monoclonal antibody, the FKBPL antibody is an excellent choice. Its effectiveness against TGF-beta makes it an essential tool for studying this important signaling pathway.</p>

<p>6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. The effectiveness of this drug has been demonstrated through patch-clamp technique studies on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.</p>

<p>ETFB antibody was raised using the C terminal of ETFB corresponding to a region with amino acids TADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP</p>

<p>Purified Polyclonal TC10 antibody</p>