Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
TALDO1 antibody
The TALDO1 antibody is a highly specialized protein that belongs to the group of polyclonal antibodies. It is used in life sciences research to detect and study transaldolase, an important enzyme involved in nucleic acid metabolism. This antibody specifically binds to TALDO1, making it a valuable tool for identifying and quantifying this biomarker in various biological samples. By targeting specific polypeptides, the TALDO1 antibody enables researchers to gain insights into the role of transaldolase in cellular processes and disease development. Its high specificity and sensitivity make it an essential component in many scientific experiments and studies.
MPT64 antibody
The MPT64 antibody is a highly specific monoclonal antibody that acts as an inhibitor against certain viruses and antibodies. It is commonly used in the field of Life Sciences for various applications. This antibody has been shown to have a strong affinity for interferon-gamma (IFN-gamma), a potent growth factor involved in immune response regulation. Additionally, it has the ability to bind to nuclear proteins and inhibit polymerase chain reactions (PCR). The MPT64 antibody can also be used to detect virus surface antigens in human serum samples, making it a valuable tool in diagnostic testing. With its electrode-activated properties, this antibody ensures accurate and reliable results in research and clinical settings.
Lamin B1 antibody
Lamin B1 antibody was raised using the middle region of LMNB1 corresponding to a region with amino acids EEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM
