Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,709 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(738 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75327 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
CRTC2 antibody
<p>The CRTC2 antibody is a highly specialized antibody that targets the phosphatase activity of CRTC2, a protein kinase involved in various cellular processes. This antibody has antiviral properties and can neutralize the effects of TGF-beta, a key signaling molecule involved in cell growth and differentiation. It is available in both polyclonal and monoclonal forms, allowing for flexibility in experimental design. The CRTC2 antibody has been extensively studied in the field of life sciences and has shown promising results in the activation of mesenchymal stem cells and modulation of P2X receptors. Additionally, this antibody has been found to have synergistic effects when combined with red ginseng, further enhancing its therapeutic potential.</p>BCAS2 antibody
<p>BCAS2 antibody was raised using the middle region of BCAS2 corresponding to a region with amino acids SKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF</p>VTA1 antibody
<p>VTA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYT</p>RAGE antibody
<p>RAGE antibody was raised using the N terminal of RAGE corresponding to a region with amino acids MKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVVFDRKSGSLALICEL</p>TRIM24 antibody
<p>The TRIM24 antibody is a highly effective neutralizing agent that targets actin filaments and fibrinogen in Life Sciences research. It is commonly used in immunoassays to detect and quantify specific proteins of interest. This monoclonal antibody, derived from colloidal gold particles, exhibits high specificity and sensitivity in detecting target molecules. It can be used for various applications including Western blotting, ELISA, immunohistochemistry, and flow cytometry. The TRIM24 antibody has been extensively validated and proven to provide reliable results in research experiments. Its unique properties make it an essential tool for scientists studying protein interactions, signal transduction pathways, and cellular processes. With its exceptional performance, this antibody offers researchers the opportunity to gain valuable insights into the molecular mechanisms underlying various diseases and biological phenomena.</p>RIOK2 antibody
<p>RIOK2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDYNRHAVVMELINGYPLCQIHHVEDPASVYDEAMELIVKLANHGLIHGD</p>RPS8 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting strong bactericidal activity. Through transcription-quantitative polymerase chain techniques, its high frequency of human activity has been verified. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, this drug binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>RBM4 antibody
<p>RBM4 antibody was raised using the C terminal of RBM4 corresponding to a region with amino acids LQQQPLLLLLQLPLHITGGIGAPCVALQPQSPLLERATVTGMRVSCPKLQ</p>ZGPAT antibody
<p>ZGPAT antibody was raised using the middle region of ZGPAT corresponding to a region with amino acids LLREAVVEGDGILPPLRTEATESDSDSDGTGDSSYARVVGSDAVDSAQSS</p>Mannose 6-Phosphate Receptor antibody
<p>Mannose 6-phosphate receptor antibody was raised in mouse using purified Bovine 300 kDa CI-MPR. as the immunogen.</p>Histone H4 antibody
<p>Histone H4 antibody is a polyunsaturated antibody that specifically targets the histone H4 protein. This antibody has been shown to neutralize the activity of arachidonic acid, a key molecule involved in various biological processes. By blocking the action of arachidonic acid, this antibody can inhibit the angiogenic response and reduce inflammation. It has also been used in Life Sciences research to study the effects of chemical inhibitors on erythropoietin and other angiogenesis-related proteins. Additionally, this monoclonal antibody has been utilized to investigate the role of histone H4 in arachidonic acid metabolism and its impact on cellular processes. With its high specificity and ability to target activated histone H4 residues, this antibody is an essential tool for studying the intricate mechanisms of arachidonic acid signaling pathways and their involvement in various physiological and pathological conditions.</p>DCK antibody
<p>DCK antibody was raised using the middle region of DCK corresponding to a region with amino acids QLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQD</p>
