Primary Antibodies

<p>Rabbit polyclonal SGK3 antibody</p>

<p>Rabbit polyclonal LAMA2 antibody</p>

<p>PNRC1 antibody was raised in rabbit using the middle region of PNRC1 as the immunogen</p>

<p>TUBA8 antibody was raised in rabbit using the N terminal of TUBA8 as the immunogen</p>

<p>RNF128 antibody was raised in rabbit using the C terminal of RNF128 as the immunogen</p>

<p>This HRP Conjugated Goat anti-Dog IgE specifically reacts with the IgE heavy chain and not with IgG, IgA, IgM or IgD. It is suitable for use as the detection antibody in various immunoassays.</p>

<p>Rabbit polyclonal FOS antibody (Thr232)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds known for their bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Its effectiveness has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.</p>

<p>ZFYVE28 antibody was raised in rabbit using the N terminal of ZFYVE28 as the immunogen</p>

<p>Rabbit Polyclonal FKHR antibody (Ser256)</p>

<p>IgG2a Negative Control Monoclonal Antibody</p>

<p>CCDC16 antibody was raised in rabbit using the middle region of CCDC16 as the immunogen</p>

<p>MIP1 beta antibody was raised in rabbit using highly pure recombinant human MIP-1-beta as the immunogen.</p>

<p>LOC441956 antibody was raised using the N terminal of LOC441956 corresponding to a region with amino acids APEDPASLRHGLWHQRTQPLAPWTMAAEDPAPRILDYGSRGPSLPASWTK</p>

<p>FMNL2 antibody was raised in Rabbit using Human FMNL2 as the immunogen</p>

<p>Purified Polyclonal ZNF280A antibody</p>

<p>CD152 antibody was raised in hamster using murine CD152/CTLA-4 as the immunogen.</p>

<p>XPNPEP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFS</p>

<p>The CD3 zeta antibody is a polyclonal antibody that has various applications in the field of Life Sciences. It is commonly used for research purposes, particularly in the study of antiviral responses and immune regulation. The CD3 zeta antibody has been shown to neutralize the effects of certain viruses, such as botulinum, by blocking their entry into host cells. Additionally, it has been found to modulate the activity of TGF-beta, a cytokine involved in immune cell function and inflammation. In addition to its antiviral properties, the CD3 zeta antibody has also been studied for its potential role in cancer therapy. Studies have demonstrated that this antibody can activate phosphatase enzymes and inhibit the growth of cancer cells, including MCF-7 breast cancer cells. Furthermore, it has been suggested that the CD3 zeta antibody may interact with P2X receptors and cannabinoid receptors, potentially influencing cellular signaling pathways. Overall, this versatile antibody holds promise for a wide</p>

<p>C19ORF47 antibody was raised using the C terminal Of C19Orf47 corresponding to a region with amino acids DSQVTSTKSKSSAEVKVTIKRTLVGPRGSSSSEGLGAQMDHAGTVSVFKR</p>