Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
PTBP2 antibody
PTBP2 antibody was raised using the N terminal of PTBP2 corresponding to a region with amino acids MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGE
TIE1 antibody
The TIE1 antibody is a highly specific antibody that targets the TIE1 protein, which is an important receptor involved in various biological processes. This monoclonal antibody is widely used in life sciences research to study the role of TIE1 in insulin signaling, adiponectin signaling, and growth factor regulation.
EGFR antibody
The EGFR antibody is a highly effective growth factor that targets the c-myc protein. It is available in both polyclonal and monoclonal forms, offering versatility in its applications. This cytotoxic antibody has been extensively studied and proven to be effective in various assays, including the inhibition of human chorionic gonadotropin (hCG) and anti-VEGF assays. The EGFR antibody specifically targets nuclear glycoproteins, making it an ideal choice for research involving inhibitors and other nuclear-related studies. With its high specificity and potency, this monoclonal antibody is a valuable tool for researchers in the field of molecular biology and beyond.
GOLM1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been proven through extensive testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.
HAV VP1 antibody
HAV VP1 antibody is a monoclonal antibody that specifically targets the HAV VP1 protein. This antibody can be used in various applications, including immunoassays and protein detection. The HAV VP1 antibody is highly specific and exhibits strong binding affinity to the target protein, ensuring accurate and reliable results.
PSA antibody
The PSA antibody is a monoclonal antibody that specifically targets the prostate-specific antigen (PSA) found in human serum. It is designed to bind to PSA and inhibit its activity. This antibody is produced using histidine-tagged recombinant proteins and has been shown to effectively detect PSA levels in various diagnostic tests, such as enzyme-linked immunosorbent assays (ELISA) or immunohistochemistry.
NR2F1 antibody
NR2F1 antibody was raised using the C terminal of NR2F1 corresponding to a region with amino acids VLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP
EphB1 antibody
EphB1 antibody was raised in Mouse using a purified recombinant fragment of EphB1(aa19-133) expressed in E. coli as the immunogen.
GPR81 antibody
The GPR81 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets GPR81, a receptor involved in various cellular processes. This antibody has been extensively validated through cytotoxic assays and transcription-polymerase chain reaction (PCR) experiments.
