Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
VCP antibody
The VCP antibody is a highly specialized antibody that targets various proteins involved in crucial cellular processes. It specifically recognizes β-catenin, c-myc, alpha-synuclein, and other nuclear proteins. This antibody is widely used in the field of Life Sciences for research purposes.
FABP5 antibody
The FABP5 antibody is a highly potent and cytotoxic monoclonal antibody that targets a specific molecule in the body. Antibodies are proteins produced by the immune system to recognize and neutralize foreign substances. This particular antibody has been extensively studied in the field of Life Sciences due to its ability to inhibit the activity of a ubiquitin ligase, which plays a crucial role in cellular processes.
STMN1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds with bactericidal activity. Through extensive research, it has been determined that this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication.
ABCC11 antibody
ABCC11 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSKIILIDEATASIDMETDTLIQRTIREAFQGCTVLVIAHRVTTVLNCDH
Purity:Min. 95%FABP antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bacterial growth. By acting as a bactericidal agent, this drug effectively inhibits the replication and transcription of DNA-dependent RNA polymerase, preventing the spread of tuberculosis.PFKP antibody
The PFKP antibody is a highly specialized monoclonal antibody that targets the protein kinase enzyme. It has been extensively studied for its potential therapeutic applications in various fields, including interferon research, non-alcoholic steatohepatitis treatment, and industrial protein kinase inhibitors.
LTA4H antibody
The LTA4H antibody is a monoclonal antibody that is used in the field of Life Sciences. It is designed to target and bind to LTA4H, an enzyme involved in the metabolism of fatty acids. This antibody has a low density and is highly specific, making it an ideal tool for research and diagnostic purposes. The LTA4H antibody can be used in various applications, including immunoassays, Western blotting, immunohistochemistry, and flow cytometry. It is produced using advanced nanocomposite technology, which ensures high purity and stability. This antibody is supplied with all necessary excipients and can be easily activated for use in different experimental setups. In addition to its research applications, the LTA4H antibody has also shown potential as an antiviral agent against certain viral infections.
Sheep RBC antibody (Texas Red)
Sheep RBC antibody (Texas Red) was raised in rabbit using sheep erythrocytes as the immunogen.
HHIPL1 antibody
HHIPL1 antibody was raised in rabbit using the C terminal of HHIPL1 as the immunogen
Purity:Min. 95%EMID1 antibody
EMID1 antibody was raised using the C terminal of EMID1 corresponding to a region with amino acids TMIGLYEPELGSGAGPAGTGTPSLLRGKRGGHATNYRIVAPRSRDERG
Purity:Min. 95%PDE7A antibody
PDE7A antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%Heparin antibody
Heparin antibody is a monoclonal antibody that is used to detect and diagnose heparin-induced thrombocytopenia (HIT), a condition in which the body's immune system produces antibodies against heparin, a commonly used blood thinner. This antibody specifically targets the complex formed between heparin and platelet factor 4 (PF4), which is responsible for the immune response leading to HIT. Heparin antibody can also be used in research settings to study the interactions between heparin and other molecules, such as insulin. Additionally, this antibody has been used in the development of therapeutic monoclonal antibodies, such as trastuzumab, which is used to treat certain types of cancer. Its high specificity and sensitivity make it a valuable tool in various applications within the field of life sciences.
