Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
Syntaxin 4 antibody
The Syntaxin 4 antibody is a highly specific monoclonal antibody that acts as an inhibitor against certain oncogenic kinases. This antibody targets the binding proteins involved in the activation of these kinases, effectively blocking their activity and preventing the growth and proliferation of cancer cells.
PRSS16 antibody
PRSS16 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQ
Purity:Min. 95%Rabbit anti Cat IgG (H + L) (biotin)
Rabbit anti-cat IgG (H+L) (biotin) was raised in rabbit using feline IgG whole molecule as the immunogen.
Purity:Min. 95%ALDH1A1 antibody
The ALDH1A1 antibody is a highly specific monoclonal antibody that targets ALDH1A1, an important enzyme involved in the metabolism of amides and lipoprotein lipase. This antibody has been extensively studied in the field of life sciences and has shown promising results in various research applications.
BECN1 antibody
The BECN1 antibody is a monoclonal antibody that has been specifically designed to target and bind to the BECN1 protein. This protein plays a crucial role in autophagy, which is the process by which cells break down and recycle their own components. By binding to BECN1, this antibody activates the autophagy pathway, leading to increased cell survival and improved cellular function.
DLC1 antibody
DLC1 antibody was raised using the C terminal of DLC1 corresponding to a region with amino acids NLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGL
AMACR antibody
AMACR antibody was raised in Mouse using a purified recombinant fragment of human AMACR expressed in E. coli as the immunogen.Lamin B2 antibody
The Lamin B2 antibody is a highly specialized antibody that targets the phosphorylation site on the lamin B2 protein. This antibody is widely used in Life Sciences research for its ability to detect and study the role of lamin B2 in various cellular processes. Lamin B2 is an important component of the nuclear lamina, which provides structural support to the nucleus and regulates gene expression. By targeting the phosphorylation site on lamin B2, this antibody allows researchers to investigate the impact of phosphorylation on lamin B2 function and its implications in immunomodulation, antinociceptive effects, and pluripotent stem cell differentiation. With its high specificity and sensitivity, this antibody is an essential tool for scientists working in fields such as cell biology, molecular biology, and immunology. Whether you are studying vaccine strains, developing new medicines, or exploring novel therapeutic strategies, the Lamin B2 antibody will be a valuable asset in your research.
CD117 antibody (Spectral Red)
CD117 antibody (biotin) was raised in rat using murine CD117/c-Kit as the immunogen.
Purity:Min. 95%
