Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75602 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
UBA5 antibody
The UBA5 antibody is a highly specialized protein kinase and phosphatase that plays a crucial role in various Life Sciences applications. It is widely used in research laboratories for its ability to detect and quantify specific proteins and biomolecules. This antibody has been extensively studied and proven to be effective in detecting targets such as alpha-fetoprotein, genotoxic inhibitors, anti-beta amyloid antibodies, chemokines, and growth factors.RPS6 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. Specifically designed to combat tuberculosis infection, this active compound exhibits bactericidal activity by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase. This prevents transcription and replication, effectively halting the spread of the disease. Additionally, it has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Metabolized through various pathways including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, this drug delivers targeted treatment against Mycobacterium tuberculosis strains. With its multifaceted mechanism of action and proven efficacy, 6-Fluoro-3-indoxyl-beta-D-galactopyranosUSP48 antibody
USP48 antibody was raised using the middle region of USP48 corresponding to a region with amino acids ALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYVKeratin K13 antibody
Keratin K13 antibody was raised in mouse using Keratin K13 purified from human esophagus as the immunogen.MAGE antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug that falls under the class of rifamycins. This active compound is highly effective in treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. Its bactericidal activity has been confirmed through extensive research using techniques like patch-clamp and transcription-quantitative polymerase chain. Metabolically, this drug undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth. Experience the powerful action of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for effective treatment against tuberculosis.ATPase antibody
The ATPase antibody is a highly specialized monoclonal antibody that targets ATPases, which are enzymes responsible for hydrolyzing ATP into ADP and phosphate. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.TBCA antibody
TBCA antibody was raised in mouse using recombinant TBCA (1-108aa) purified from E. coli as the immunogen.
CGRRF1 antibody
CGRRF1 antibody was raised using the middle region of CGRRF1 corresponding to a region with amino acids KKDSKEEIYCQLPRDTKIEDFGTVPRSRYPLVALLTLADEDDREIYDIISIFIH1 antibody
IFIH1 antibody was raised using the middle region of IFIH1 corresponding to a region with amino acids QINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDEDISG15 antibody
ISG15 antibody was raised in mouse using recombinant human ISG15 (1-157aa) purified from E. coli as the immunogen.
FAM84B antibody
The FAM84B antibody is a diagnostic reagent used in the Life Sciences field. It specifically targets the FAM84B protein, which is involved in various biological processes such as lipoprotein lipase activity and growth factor signaling. This monoclonal antibody has high affinity and specificity for FAM84B, making it an excellent tool for research and diagnostic purposes. The FAM84B antibody can be used in assays to detect the presence of FAM84B in human serum or other samples. Its binding capability to serum albumin ensures stability and reliable results. Additionally, this antibody has been extensively tested for toxic effects and meets all safety standards. With its exceptional performance and reliability, the FAM84B antibody is an essential biomolecule for any researcher or laboratory working in the field of Life Sciences.Ku70 antibody
The Ku70 antibody is a highly effective anti-HER2 antibody that targets the growth factor protein VEGF-C. This monoclonal antibody exhibits multidrug resistance and has been extensively studied for its therapeutic potential. The Ku70 antibody specifically binds to HER2 receptors, inhibiting their activation and signaling pathways. Additionally, this antibody has shown promising results in blocking the interaction between HER2 and β-catenin, a key player in cancer progression. Furthermore, the Ku70 antibody has been found to disrupt cell adhesion by targeting fibronectin and collagen, leading to impaired tumor growth and metastasis. Its ability to inhibit epidermal growth factor and endothelial growth factors further contributes to its anti-cancer properties. With its exceptional specificity and potency, the Ku70 antibody holds great promise as a targeted therapy for HER2-positive cancers.KIAA1958 antibody
KIAA1958 antibody was raised using the C terminal of KIAA1958 corresponding to a region with amino acids SPITLLSTVVKYNSQYLNMRTLQEHADLMYGDIELLKDPQNQPYFARTDSACY1 antibody
The ACY1 antibody is a monoclonal antibody that targets the ACY1 protein. This protein is involved in various biological processes, including the metabolism of drugs and toxins. The ACY1 antibody can be used in Life Sciences research to study the role of ACY1 in different cellular pathways.XPB antibody
The XPB antibody is a polyclonal antibody that has an inhibitory effect on the growth factor XPB. It exhibits antioxidant activity and can be used in various applications, such as immobilization in Life Sciences research or industrial settings. The XPB antibody is commonly used in studies involving polymerase chain reactions (PCR) and molecular docking experiments. It can also be utilized as a tool for protein kinase assays. Additionally, monoclonal antibodies and DNA aptamers targeting XPB are available for specific applications. With its versatile nature and high-quality performance, the XPB antibody is an essential component in many scientific endeavors.
TMEFF2 antibody
The TMEFF2 antibody is a highly reactive monoclonal antibody that is used in the field of Life Sciences. It specifically targets TMEFF2, a protein involved in various cellular processes. This antibody can be used for applications such as immunohistochemistry, western blotting, and flow cytometry. The TMEFF2 antibody binds to TMEFF2 with high affinity, allowing for accurate detection and analysis of this protein. Its specificity ensures minimal cross-reactivity with other proteins, making it an ideal choice for research and diagnostic purposes. With its exceptional performance and reliability, the TMEFF2 antibody is a valuable tool for scientists and researchers in the Life Sciences field.Toll-like receptor 2 antibody
The Toll-like receptor 2 antibody is a highly specialized monoclonal antibody that has the ability to neutralize the activity of Toll-like receptor 2 (TLR2). TLR2 is a key player in the immune response, as it recognizes and responds to various pathogens and danger signals. This antibody has been pegylated to enhance its stability and prolong its half-life in the body.CCR5 antibody
CCR5 antibody is a type of monoclonal antibody that targets the C-C chemokine receptor, which plays a crucial role in immune response and inflammation. This antibody has minimal toxicity and has been extensively studied for its therapeutic potential in various diseases. It binds to the CCR5 receptor, preventing the interaction with its ligands such as macrophage inflammatory protein-1alpha (MIP-1α), thereby neutralizing their effects.ARF1 antibody
ARF1 antibody was raised in mouse using recombinant human ARF1 (1-181aa) purified from E. coliBECN1 antibody
The BECN1 antibody is a highly potent cytotoxic agent that targets epidermal growth factor (EGF) receptors. It is an anti-CD33 antibody that specifically binds to CD33, a transmembrane protein expressed on myeloid cells. This monoclonal antibody can be used in various life science applications, including research and diagnostics. The BECN1 antibody can be conjugated with cytotoxic agents to create cytotoxic conjugates for targeted cancer therapy. It has been extensively studied and proven to be effective in inhibiting the growth of cancer cells in preclinical models. Additionally, this antibody exhibits excellent binding specificity and minimal cross-reactivity with other proteins present in human serum. The glycosylation of the BECN1 antibody ensures stability and enhances its therapeutic potential. Overall, the BECN1 antibody is a valuable tool for researchers and clinicians working in the field of oncology and immunotherapy.CBL antibody
CBL antibody is a monoclonal antibody that targets the colony-stimulating factor CBL. It has been shown to neutralize the activity of CBL and inhibit its function in promoting cell growth and survival. This antibody can also bind to antiphospholipid antibodies and interfere with their ability to activate immune responses. Additionally, it has been demonstrated to block the interaction between E-cadherin and interferon, leading to decreased cell adhesion and migration. The CBL antibody is available in both monoclonal and polyclonal forms, providing flexibility for different experimental needs. It can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry. With its high specificity and potency, this antibody offers researchers a valuable tool for studying the role of CBL in cellular processes and disease development.Calbindin antibody (D28K)
Calbindin antibody (D28K) was raised in mouse using calbindin D-28k as the immunogen.IFNG antibody
IFNG antibody is a monoclonal antibody that specifically targets interferon-gamma (IFN-γ), a cytokine involved in immune responses. This antibody has the ability to neutralize the effects of IFN-γ by binding to it and preventing its interaction with target cells. It has been shown to have neuroprotective properties, protecting neurons from damage caused by various factors such as oxidative stress or inflammation. Additionally, IFNG antibody can be used in research and diagnostics in the life sciences field, particularly in studies involving collagen, human serum, or multidrug binding proteins. This antibody can also be immobilized on electrodes for use in immunoassays or other analytical techniques. Whether you need a high-quality product description for an eCommerce platform or engaging content for your website, I can help you create compelling copy that showcases the unique characteristics and benefits of your products. Let's work together to elevate your brand and drive sales!CD1D antibody
The CD1D antibody is a polyclonal antibody used in life sciences research. It targets CD1D, a protein involved in various cellular processes such as hepatocyte growth, chemokine production, and telomerase activity. This antibody has been shown to have cytotoxic effects on specific cell types and may be useful for studying thrombocytopenia and nephrotoxicity. Additionally, the CD1D antibody can be used to detect CXCR4 expression and inhibit its function. It belongs to the family of kinase inhibitors and is available as both colloidal and monoclonal antibodies. Researchers can rely on the high quality and specificity of this antibody for their experiments in various fields of study.AKAP5 antibody
AKAP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIEFeline Leukemia Virus p27 antibody (biotin)
Goat polyclonal Feline Leukemia Virus p27 antibody (biotin)UPB1 antibody
UPB1 antibody was raised using the middle region of UPB1 corresponding to a region with amino acids NRVGTEHFPNEFTSGDGKKAHQDFGYFYGSSYVAAPDSSRTPGLSRSRDG
p70 S6 Kinase antibody
The p70 S6 Kinase antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. This neutralizing antibody is specifically designed to target and inhibit the activity of p70 S6 Kinase, an important biomolecule involved in various cellular processes. By blocking the function of p70 S6 Kinase, this antibody can effectively modulate cell signaling pathways and regulate protein synthesis.Annexin A7 antibody
Annexin A7 antibody was raised using the N terminal of ANXA7 corresponding to a region with amino acids GGQMPSQYPGGQPTYPSQPATVTQVTQGTIRPAANFDAIRDAEILRKAMKGST Antibody
The GST Antibody is a highly specific and potent antibody that targets the cytosolic protein GST. It is designed to recognize and bind to the target molecule with high affinity, making it an ideal tool for various applications in Life Sciences research. The antibody is produced using advanced techniques, including DNA aptamer technology, resulting in a highly purified and effective product.KCNAB3 antibody
KCNAB3 antibody was raised using the N terminal of KCNAB3 corresponding to a region with amino acids RNLGKSGLRVSCLGLGTWVTFGSQISDETAEDVLTVAYEHGVNLFDTAEVNR2C2 antibody
NR2C2 antibody was raised using the C terminal of NR2C2 corresponding to a region with amino acids AQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNSCD52 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, thus inhibiting bacterial growth and preventing transcription and replication. Extensive research has been conducted on human erythrocytes using a patch-clamp technique, demonstrating its high frequency of human activity. In terms of metabolism, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.Telomerase antibody
Telomerase antibody is a monoclonal antibody that specifically targets the telomerase enzyme. Telomerase plays a crucial role in maintaining the length of telomeres, which are protective caps at the ends of chromosomes. This antibody binds to the catalytic subunit of telomerase and inhibits its activity, leading to telomere shortening and eventual cell death.GCN5L2 antibody
GCN5L2 antibody was raised in mouse using recombinant human GCN5L2 (411-837aa) purified from E. coli as the immunogen.SUPT4H1 antibody
SUPT4H1 antibody was raised in mouse using recombinant Human Suppressor Of Ty 4 Homolog 1 (S. Cerevisiae) (Supt4H1)Bcl-2 antibody
Bcl-2 antibody was raised in mouse using recombinant human Bcl-2 (1-211aa) purified from E. coli as the immunogen.ADNP antibody
ADNP antibody was raised in mouse using recombinant Human Activity-Dependent Neuroprotector HomeoboxARID4A antibody
ARID4A antibody was raised in mouse using recombinant Human At Rich Interactive Domain 4A (Rbp1-Like) (Arid4A)Human Serum amyloid A monoclonal antibody
The Human Serum amyloid A monoclonal antibody is a powerful therapeutic agent with antioxidant activity. This monoclonal antibody specifically targets human serum and has been extensively studied in the field of Life Sciences. It exhibits strong inhibitory effects on protein kinase, which plays a crucial role in various cellular processes. The Human Serum amyloid A monoclonal antibody is designed using advanced techniques such as DNA aptamers and cyclic peptides, ensuring high specificity and efficacy. Through molecular docking studies, its pharmacodynamics properties have been thoroughly investigated, making it an ideal candidate for targeted therapy. Additionally, this antibody has shown promising results in inhibiting the growth factor signaling pathways associated with certain diseases. With its industrial applications and potential use in research and clinical settings, the Human Serum amyloid A monoclonal antibody represents a significant advancement in the field of Antibodies.ATM antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a highly effective antituberculosis drug that falls under the class of rifamycins. It is known for its potent bactericidal activity against tuberculosis infection. By binding to DNA-dependent RNA polymerase, this active compound inhibits bacterial growth by preventing transcription and replication. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting cell growth in culture. The metabolization process involves various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid.HIP2 antibody
HIP2 antibody was raised in mouse using recombinant Human Huntingtin Interacting Protein 2 (Hip2)
NUFIP1 antibody
NUFIP1 antibody was raised in mouse using recombinant Human Nuclear Fragile X Mental Retardation Protein Interacting Protein 1HIVEP1 antibody
HIVEP1 antibody was raised in mouse using recombinant Human Human Immunodeficiency Virus Type I Enhancer Binding Protein 1Osteocalcin antibody
The Osteocalcin antibody is a highly specialized antibody that targets osteopontin, a basic protein involved in bone formation and remodeling. This monoclonal antibody can be used in various research applications within the Life Sciences field. It specifically binds to osteopontin and can be utilized for experiments such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). The Osteocalcin antibody has also been shown to exhibit cross-reactivity with other proteins such as serum albumin, E-cadherin, β-catenin, taxol, oncostatin, and angptl3. Its high specificity and sensitivity make it an invaluable tool for studying bone biology and related diseases.PDK1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is known to be the most effective rifamycin in treating tuberculosis infections. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its high activity has been demonstrated using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
GLUT2 antibody
The GLUT2 antibody is a growth factor that has been activated and neutralized to provide effective results. It has been tested in human serum and has shown promising results in inhibiting the activity of alpha-fetoprotein, a protein associated with certain cancers. Additionally, this antibody has demonstrated the ability to block chemokine activity, which plays a role in inflammation and immune response.
PTPMT1 antibody
The PTPMT1 antibody is a highly specialized antibody used in the field of Life Sciences. It specifically targets and binds to the epidermal growth factor, making it an essential tool for research and diagnostic purposes. This antibody is available in both monoclonal and polyclonal forms, allowing researchers to choose the best option for their specific needs.C4ORF23 antibody
C4ORF23 antibody was raised using the N terminal Of C4Orf23 corresponding to a region with amino acids LTPWIPVIAARSSYNCRFFVLPCCFFDFIGRYSRRQSKKTQYREYLDFIKFibroblast antibody
Fibroblast antibody was raised in mouse using whole human thymic stoma cells as the immunogen.
HER2 antibody
The HER2 antibody is a protein that belongs to the family of collagen antibodies. It is an anti-HER2 antibody that acts as a kinase inhibitor, targeting the epidermal growth factor receptor. This antibody is widely used in the field of Life Sciences for research purposes. It has been shown to inhibit the signaling pathways of HER2, which is involved in cell proliferation and survival. Additionally, the HER2 antibody has been found to have therapeutic potential in the treatment of various diseases, including breast cancer. It can be used in combination with other treatments, such as trastuzumab, a monoclonal antibody, to enhance their efficacy. The HER2 antibody can also be utilized in immunoassays and diagnostic tests due to its high specificity and sensitivity. Its diverse applications make it an essential tool for researchers and clinicians alike.MAT1 antibody
MAT1 antibody is a polyclonal antibody that specifically targets the activated form of alpha-fetoprotein (AFP) in human serum. This antibody has been shown to neutralize the chemokine activity of AFP, which plays a crucial role in various biological processes. Additionally, MAT1 antibody has genotoxic effects on cancer cells by inhibiting the activity of certain phosphatases and tyrosine kinase receptors. It can be used in bioassays to study the trifunctional nature of AFP as a growth factor and chemokine. Moreover, MAT1 antibody is widely used in life sciences research for its anti-beta amyloid properties, making it an essential tool for studying neurodegenerative diseases such as Alzheimer's. With its high specificity and sensitivity, this antibody ensures accurate and reliable results in various experimental settings.Lck antibody
The Lck antibody is a highly specialized product in the field of Life Sciences. It is a growth factor that exhibits colloidal properties, which contribute to its high viscosity. This antibody is specifically designed to target and bind to Lck, a protein kinase involved in signal transduction pathways. By binding to Lck, this antibody can modulate its activity and downstream signaling events.MEF2A antibody
The MEF2A antibody is a polyclonal antibody that targets the growth factor MEF2A. It is used in life sciences research to study the role of MEF2A in various cellular processes. This antibody specifically binds to MEF2A and can be used for applications such as immunofluorescence, immunohistochemistry, and western blotting. Additionally, it has been shown to have neutralizing properties against interferon-gamma (IFN-gamma) and basic protein autoantibodies. The MEF2A antibody is a valuable tool for researchers studying endothelial growth, chemokine signaling, and intraocular diseases.XAF1 antibody
XAF1 antibody was raised using the middle region of XAF1 corresponding to a region with amino acids RSINRFPLHSESSSKKAPRSKNKTLDPLLMSEPKPRTSSPRGDKAAYDILARG1 antibody
ARG1 antibody is a test compound that acts as an inhibitor of the growth factor ARG1. It belongs to the class of antibodies and specifically targets interferon-gamma (IFN-gamma). This polyclonal antibody is widely used in Life Sciences research for its neutralizing properties against ARG1. It can effectively block the activity of ARG1, which plays a crucial role in various physiological processes such as the regulation of basic protein and chemokine production. The use of ARG1 antibody has also been implicated in autoantibody-mediated disorders and has shown potential therapeutic effects in regulating acetylcholine and endothelial growth. Whether you're conducting experiments or studying specific pathways, this monoclonal antibody offers reliable and accurate results for your research needs.Nucleolin antibody
Nucleolin antibody was raised using the N terminal of NCL corresponding to a region with amino acids GKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDED
DLX5 antibody
The DLX5 antibody is a highly specialized and potent tool in the field of life sciences. It is a polyclonal antibody that specifically targets DLX5, a transcription factor involved in various cellular processes. This antibody can be used for research purposes, such as studying the role of DLX5 in development and disease progression.GREM2 antibody
GREM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIKSRP68 antibody
SRP68 antibody was raised using the N terminal of SRP68 corresponding to a region with amino acids EENKENERPSAGSKANKEFGDSLSLEILQIIKESQQQHGLRHGDFQRYRGChlamydia trachomatis antibody (biotin)
Chlamydia trachomatis antibody (biotin) was raised in rabbit using L2 and other serovar groups as the immunogen.IFITM3 antibody
The IFITM3 antibody is a polyclonal antibody that acts as an immunomodulatory agent. It specifically targets the glycoprotein IFITM3, which plays a crucial role in various biological processes. This antibody is widely used in the field of Life Sciences to study the function and regulation of IFITM3.Enolase 3 antibody
Enolase 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRPDXP antibody
PDXP antibody was raised using a synthetic peptide corresponding to a region with amino acids DPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSI
HIST1H1C antibody
HIST1H1C antibody was raised using the middle region of HIST1H1C corresponding to a region with amino acids ASGSFKLNKKAASGEAKPKVKKAGGTKPKKPVGAAKKPKKAAGGATPKKS
ATF4 antibody
The ATF4 antibody is a polyclonal antibody that belongs to the group of antibodies used in Life Sciences research. It specifically targets ATF4, a transcription factor involved in cellular stress response and regulation of gene expression. This antibody can be used for various applications, such as Western blotting, immunohistochemistry, and immunofluorescence.
SORL1 antibody
SORL1 antibody was raised in Mouse using a purified recombinant fragment of SORL1(aa2159-2214) expressed in E. coli as the immunogen.C12ORF24 antibody
C12ORF24 antibody was raised using the N terminal Of C12Orf24 corresponding to a region with amino acids AVAGTEGGGGGSAGYSCYQNSKGSDRIKDGYKVNSHIAKLQELWKTPQNQCD206 antibody
The CD206 antibody is a highly specialized antibody that belongs to the family of polyclonal antibodies. It is commonly used in life sciences research and has been proven to be effective in various applications. This antibody specifically targets the CD206 protein, which plays a crucial role in cell growth and development. The CD206 antibody has shown great potential as a growth factor, particularly in promoting the growth and proliferation of mesenchymal stem cells. Additionally, it has been found to have activated fatty acid metabolism and collagen synthesis pathways, making it an essential tool for studying these processes. Researchers have also discovered that the CD206 antibody can inhibit the activity of certain kinases, making it a valuable family kinase inhibitor. Whether you're studying chemokines or investigating epidermal growth factors, the CD206 antibody is an indispensable resource that will undoubtedly yield insightful results.Factor XI antibody
Factor XI antibody was raised in goat using human Factor XI purified from plasma as the immunogen.SYK antibody
SYK antibody was raised in Mouse using a purified recombinant fragment of SYK(aa296-484) expressed in E. coli as the immunogen.ICAM1 antibody
The ICAM1 antibody is a highly effective inhibitor that targets the vascular endothelial growth factor (VEGF) and other growth factors. It works by blocking the binding of these factors to their receptors, thereby preventing the activation of downstream signaling pathways. This antibody has been shown to inhibit the production of superoxide, a reactive oxygen species that plays a key role in inflammation and oxidative stress. Additionally, it inhibits protein kinase activity, which is involved in various cellular processes such as cell proliferation and survival. The ICAM1 antibody is a polyclonal antibody that has been extensively tested and validated for use in research studies in the field of life sciences. It can be used in various applications, including Western blotting, immunohistochemistry, and flow cytometry. This antibody specifically binds to ICAM1, a cell surface glycoprotein that is involved in cell adhesion and immune response regulation. Its binding properties have been optimized to ensure high specificity and sensitivity. The ICAM1 antibody is anMAP2K4 antibody
MAP2K4 antibody was raised in Mouse using a purified recombinant fragment of MAP2K4 expressed in E. coli as the immunogen.TEX9 antibody
TEX9 antibody was raised using the middle region of TEX9 corresponding to a region with amino acids QAASSQSATEVRLNRALEEAEKYKLELSKLRQNNKDIANEEHKKIEVLKSPLXDC1 antibody
The PLXDC1 antibody is a monoclonal antibody that specifically targets the PLXDC1 protein. This protein is involved in various cellular processes, including platelet fibrinogen binding and arginase activity. The PLXDC1 antibody can be used in research and diagnostics to study the expression and function of PLXDC1.CDH5 antibody
The CDH5 antibody is a highly specialized antibody that targets the CDH5 protein. This protein is involved in various cellular processes, including cell adhesion and growth factor signaling. The CDH5 antibody can be used to detect the presence of CDH5 in nuclear extracts, making it a valuable tool for research in the field of molecular biology.GRIPAP1 antibody
GRIPAP1 antibody was raised using the N terminal of GRIPAP1 corresponding to a region with amino acids ENTALQKNVAALQERYGKEAGKFSAVSEGQGDPPGGPAPTVLAPMPLAEVPPM1B antibody
The PPM1B antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the circumsporozoite protein, an antigen involved in endothelial growth and development. By binding to this protein, the PPM1B antibody can inhibit the activity of growth factors such as collagen, fibronectin, and VEGF-C. This antibody is commonly used in immunohistochemistry studies to visualize and analyze the expression of endothelial growth factors in various tissues. Its high specificity and affinity make it a valuable tool for researchers studying angiogenesis and other processes related to endothelial growth.CATSPER2 antibody
CATSPER2 antibody was raised using the C terminal of CATSPER2 corresponding to a region with amino acids LMEMDQDDRVWPRDSLFRYFELLEKLQYNLEERKKLQEFAVQALMNLEDKLOX antibody
The LOX antibody is a glycoprotein that is found in human serum and has been shown to have various functions. It plays a role in regulating the activity of mesenchymal stem cells and can interact with fibrinogen. The LOX antibody is a monoclonal antibody that is capable of neutralizing the effects of LOX. Monoclonal antibodies are highly specific and can be used for various applications in the field of Life Sciences. The LOX antibody can be produced using an expression plasmid and can be immobilized on a carbon electrode for use in electrochemical assays. This antibody has potential applications in research, diagnostics, and therapeutics, particularly in the study of chemokines and their role in various diseases.SHC1 antibody
The SHC1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize specific virus surface antigens, making it an essential tool for researchers studying viral infections. Additionally, this antibody has been found to have potential therapeutic applications in the development of DNA vaccines.
Cytochrome C antibody
The Cytochrome C antibody is a monoclonal antibody that specifically binds to cytochrome C, a human protein involved in various cellular processes. This antibody is commonly used in Life Sciences research and diagnostic applications. It can be used for receptor binding studies, hybridization assays, and cellular assays to detect the presence of cytochrome C in various samples such as human serum or tissue lysates. The Cytochrome C antibody is highly specific and has high affinity towards its target, making it a valuable tool for scientists studying cytochrome C function and its role in disease development. Whether you're conducting basic research or developing new diagnostic tools, this monoclonal antibody is an essential component in your toolkit.PROS1 antibody
The PROS1 antibody is a highly effective medicament that belongs to the class of antibodies. It has been extensively studied for its therapeutic potential in various medical conditions. This antibody specifically targets and binds to PROS1, a protein involved in regulating blood coagulation and cell growth.VIPAR antibody
VIPAR antibody was raised using the middle region of VIPAR corresponding to a region with amino acids VEDVDTKLNLATKFKCHDVVIDTYRDLKDRQQLLAYRSKVDKGSAEEEKIC22ORF9 antibody
C22ORF9 antibody was raised using the middle region of C22Orf9 corresponding to a region with amino acids ERVTSFSTPPTPERNNRPAFFSPSLKRKVPRNRIAEMKKSHSANDSEEFFCytokeratin 18 antibody
Cytokeratin 18 antibody was raised using the C terminal of KRT18 corresponding to a region with amino acids ALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIVVPS25 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
