Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Found 75602 products of "Primary Antibodies"
PEX5 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Extensive research has been conducted using the patch-clamp technique on human erythrocytes, confirming its high efficacy. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.BAD antibody
The BAD antibody is a highly specialized monoclonal antibody that is designed for immunohistochemistry applications. This antibody is specifically designed to detect and bind to the BAD protein, which plays a crucial role in cell apoptosis. The BAD antibody has been extensively tested and validated for its specificity and sensitivity in detecting the presence of the BAD protein in various tissues and cell types.RXRG antibody
RXRG antibody was raised using the N terminal of RXRG corresponding to a region with amino acids NVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICAICGDRSSGKHJun antibody
The Jun antibody is a monoclonal antibody that specifically targets the protein Jun. It is widely used in Life Sciences research for various applications such as proteinase assays, detection of polypeptide sequences, and analysis of protein-protein interactions. The Jun antibody has high affinity and specificity for its target antigen, making it an essential tool for studying the function and localization of Jun in cells. Additionally, this antibody is commonly used in experiments involving human chorionic gonadotropin (hCG), extracellular matrix proteins, morphogenetic proteins, nuclear factors, growth factors, and other related molecules. With its reliable performance and versatility, the Jun antibody is a valuable asset for researchers in diverse fields.RBM9 antibody
RBM9 antibody was raised using the N terminal of RBM9 corresponding to a region with amino acids STQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKRLRPL8 antibody
The RPL8 antibody is a highly effective inhibitor that belongs to the class of antibodies. It is widely used in Life Sciences for various applications, including the study of interleukin and adeno-associated viruses. This antibody has been extensively tested and proven to be highly specific, making it an ideal tool for researchers in the field. With its high affinity and exceptional binding capabilities, the RPL8 antibody can be used as an affinity ligand to isolate and purify target proteins from complex mixtures. Additionally, this antibody has shown promising results as a potential medicament, with its ability to target autoantibodies and provide therapeutic benefits. Whether you are working on extracellular studies or isolated retinal experiments, the RPL8 antibody is a valuable asset that can greatly enhance your research outcomes.CCKBR antibody
The CCKBR antibody is a bioactive natural product that serves as a test substance for various applications. It exhibits cytotoxic properties and has been shown to enhance protein thermal stability. This antibody can be used in research settings for the isolation of nucleic acids and the detection of specific proteins through electrophoresis. Additionally, the CCKBR antibody demonstrates antibody activity, making it a valuable tool in the field of life sciences. Its potential applications include the development of anticancer drugs and antibodies, as well as testing various substances for their efficacy as anticancer agents. With its nuclear targeting capabilities, this antibody holds promise for advancing scientific knowledge and contributing to breakthrough discoveries in cancer research.TMEM146 antibody
TMEM146 antibody was raised using the N terminal of TMEM146 corresponding to a region with amino acids LIQDVQGDRLYFHPTTTRLIKHPCEKNIALYLGKQVFFTMDNFETSLLPF
Purity:Min. 95%Cytokeratin 5 antibody
Cytokeratin 5 antibody is a monoclonal antibody that specifically targets the Cytokeratin 5 protein. This protein is found in various tissues and is commonly used as a marker for epithelial cells. The antibody recognizes specific epitopes on the Cytokeratin 5 protein, allowing for its detection and localization in samples.CDC5L antibody
CDC5L antibody was raised using a synthetic peptide corresponding to a region with amino acids LHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDECD20 antibody
CD20 antibody was raised in Mouse using synthetic peptide corresponding to aa (EPANPSEKNSPSTQY) of human CD20, conjugated to KLH, as the immunogen.
CNOT6 antibody
CNOT6 antibody was raised using the N terminal of CNOT6 corresponding to a region with amino acids EISGKVRSLSASLWSLTHLTALHLSDNSLSRIPSDIAKLHNLVYLDLSSNALS2 antibody
ALS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALRGMSDLPPYGSGSSVQRQEPPISRSAKYTFYKDPRLKDATYDGRWLSGHuman Growth Hormone antibody
Human growth hormone antibody was raised in mouse using human pituitary GH as the immunogen.
IPPK antibody
IPPK antibody was raised using the middle region of IPPK corresponding to a region with amino acids KTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQIDGPYDEAFYQK
ZMYND19 antibody
ZMYND19 antibody was raised in rabbit using the middle region of ZMYND19 as the immunogenPurity:Min. 95%MINK1 antibody
MINK1 antibody was raised in rabbit using the middle region of MINK1 as the immunogen
Purity:Min. 95%ROCK1 antibody
The ROCK1 antibody is a highly specific monoclonal antibody that targets the protein ROCK1. This protein plays a crucial role in various cellular processes, including cell growth, migration, and proliferation. By inhibiting the activity of ROCK1, this antibody can effectively block the signaling pathway associated with growth factors and histidine kinases.RBPMS antibody
RBPMS antibody was raised using the middle region of RBPMS corresponding to a region with amino acids PASLHAQCFSPEAKPNTPVFCPLLQQIRFVSGNVFVTYQPTADQQRELPCClock antibody
The Clock antibody is a monoclonal antibody that belongs to the field of Life Sciences. It is specifically designed for neuroprotective purposes and is highly effective in targeting and neutralizing the Clock protein. This antibody has been extensively tested and proven to have high affinity and specificity for its target. It can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. The Clock antibody is colloidal gold-conjugated, making it easy to detect with a simple color change reaction. It has also been shown to inhibit the activity of growth factors like endothelial growth factor and glucagon, making it a valuable tool in studying cellular signaling pathways. With its superior performance and reliability, this antibody is an essential component for any research or diagnostic project related to circadian rhythm regulation or clock genes.
GABRG2 antibody
GABRG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPAPTIDIR
SAAL1 antibody
SAAL1 antibody was raised using the N terminal of SAAL1 corresponding to a region with amino acids MDRNPSPPPPGRDKEEEEEVAGGDCIGSTVYSKHWLFGVLSGLIQIVSPEZNF780A antibody
ZNF780A antibody was raised in rabbit using the N terminal of ZNF780A as the immunogenPurity:Min. 95%MUC1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to treat tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. The effectiveness of this drug has been demonstrated using advanced techniques like the patch-clamp technique on human erythrocytes.
ING1 antibody
The ING1 antibody is a polyclonal antibody that specifically targets the colony-stimulating factor known as acidic m-CSF. It is widely used in life sciences research for its ability to detect and measure the levels of this important protein. The ING1 antibody has been extensively tested and validated for its high specificity and sensitivity, making it a reliable tool for researchers studying the role of colony-stimulating factors in various biological processes.
Annexin A11 antibody
Annexin A11 antibody was raised using the C terminal of ANXA11 corresponding to a region with amino acids RIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTSGDYRKILLKICGGNDMKK6 antibody
The MKK6 antibody is a basic protein used in Life Sciences research. It is an essential tool for studying various cellular processes and pathways. This antibody can be used in experiments involving electrodes, as it forms disulfide bonds with target molecules, allowing for precise detection and analysis. The MKK6 antibody has been shown to have drug-like properties, making it an excellent candidate for developing therapeutic antibodies. It has also been found to interact with collagen and colloidal particles, further expanding its potential applications. Additionally, this antibody exhibits cytotoxic effects and can induce apoptosis through the tumor necrosis factor-related apoptosis-inducing (TNF-related apoptosis-inducing) pathway. Its binding affinity to CD3 receptors and alpha-fetoprotein makes it a valuable tool in immunological studies. The MKK6 antibody is highly specific and shows minimal cross-reactivity with other proteins present in human serum.
CYP17A1 antibody
The CYP17A1 antibody is a monoclonal antibody that specifically targets the human serum. It is commonly used in research and diagnostic laboratories to detect and measure the levels of CYP17A1, a growth factor that plays a crucial role in various physiological processes. This monoclonal antibody has been extensively characterized and validated for its specificity and sensitivity.NLRP1 antibody
NLRP1 antibody was raised using the N terminal of NLRP1 corresponding to a region with amino acids DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCRELRabbit anti Mouse IgG2b (Texas Red)
Rabbit anti-mouse IgG2b was raised in rabbit using murine IgG2b heavy chain as the immunogen.
PTOV1 antibody
PTOV1 antibody was raised in rabbit using the N terminal of PTOV1 as the immunogenPurity:Min. 95%WNT5A antibody
WNT5A antibody was raised in Mouse using a purified recombinant fragment of WNT5A expressed in E. coli as the immunogen.Aflatoxin antibody
The Aflatoxin antibody is a monoclonal antibody that specifically targets aflatoxins, which are toxic compounds produced by certain types of fungi. This antibody has been extensively studied in the field of Life Sciences and has shown excellent binding affinity to aflatoxins. It can be used in various applications such as ELISA assays, immunohistochemistry, and Western blotting.RPL10A antibody
RPL10A antibody was raised using the middle region of RPL10A corresponding to a region with amino acids YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKPI16 antibody
The PI16 antibody is a highly specialized monoclonal antibody that targets protein kinase activity. It has been extensively researched and proven to exhibit cytotoxic effects on various cell types. This antibody is widely used in the field of Life Sciences, particularly in studies involving antibodies and their role in cellular processes. The PI16 antibody specifically recognizes and binds to non-phosphorylated protein isoforms, such as β-catenin, which are involved in key signaling pathways. Its activation leads to a cascade of events that ultimately result in cellular responses. Additionally, this antibody has shown reactivity towards glutamate receptors and has been found to modulate their function. With its unique properties, the PI16 antibody is an invaluable tool for researchers working with pluripotent cells and studying autoantibodies.SURF6 antibody
SURF6 antibody was raised using the middle region of SURF6 corresponding to a region with amino acids EPREPPGLIFNKVEVSEDEPASKAQRRKEKRQRVKGNLTPLTGRNYRQLLSEC31A antibody
The SEC31A antibody is a highly specialized monoclonal antibody that targets the SEC31A protein. This protein plays a crucial role in cell function and is involved in various processes such as lipoprotein lipase, multidrug resistance, retinoid metabolism, collagen synthesis, and growth factor signaling.ENOX1 antibody
ENOX1 antibody was raised using the middle region of ENOX1 corresponding to a region with amino acids QQLQFLQQTMQGMQQQLLTIQEELNNKKSELEQAKEEQSHTQALLKVLQEOmp antibody
Omp antibody was raised in rabbit using the C terminal of Omp as the immunogen
Purity:Min. 95%RNH1 antibody
RNH1 antibody was raised using the middle region of RNH1 corresponding to a region with amino acids LLHPSSRLRTLWIWECGITAKGCGDLCRVLRAKESLKELSLAGNELGDEG
FBXO16 antibody
FBXO16 antibody was raised using the C terminal of FBXO16 corresponding to a region with amino acids SPLSAFRSSSSLRKKNNSGEKALPPWRSSDKHPTDIIRFNYLDNRDPMET
TSH antibody
TSH antibody is a monoclonal antibody that specifically targets and neutralizes galectin-3-binding. It is an activated, low-density antibody that has been extensively studied in the field of Life Sciences. TSH antibody has shown promising results in interfering with collagen production, making it a potential therapeutic agent for conditions related to collagen dysregulation. Additionally, this antibody has demonstrated its ability to inhibit the glycation process and reduce the levels of interleukin-6, a pro-inflammatory cytokine. Furthermore, TSH antibody has been proven effective in bioassays targeting fatty acid metabolism. With its unique characteristics and potent bioactivity, TSH antibody holds great promise for future research and clinical applications.Tropomyosin antibody
Tropomyosin antibody is a glycopeptide used in Life Sciences research. It is a monoclonal antibody that specifically targets the CD33 protein. This antibody is commonly used in studies involving Monoclonal Antibodies and Antibodies to investigate the role of CD33 in various biological processes. Tropomyosin antibody has been shown to have neutralizing effects on colony-stimulating factors, which are important for regulating cell growth and differentiation. Additionally, it has been found to bind to proteins involved in blood clotting, such as fibrinogen, suggesting potential anticoagulant properties. The glycosylation of this antibody enhances its stability and binding affinity, making it an excellent tool for researchers studying CD33-related pathways.VASP antibody
The VASP antibody is a highly reactive antibody that specifically targets interleukin-6 (IL-6). It is derived from an expression plasmid and belongs to the class of monoclonal antibodies. This antibody has been extensively used in Life Sciences research to study the expression and function of IL-6 in various biological systems.
HSPB2 antibody
HSPB2 antibody was raised using the middle region of HSPB2 corresponding to a region with amino acids VRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEAGTR1 antibody
The AGTR1 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and inhibit the chemokine receptor AGTR1, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in blocking the activation of AGTR1.Goat anti Armenian Hamster IgG (H + L) (HRP)
Goat anti-armenian hamster IgG (H + L) (HRP) was raised in goat using hamster IgG (H & L) as the immunogen.MYSM1 antibody
The MYSM1 antibody is a highly specialized monoclonal antibody that is used in various assays and research applications. It is specifically designed to target and bind to MYSM1, a protein found in human hepatocytes. The antibody is produced using advanced techniques that involve the fusion of human and bovine γ-globulin, resulting in a chimeric protein with high specificity and sensitivity.C1D antibody
C1D antibody was raised in rabbit using the N terminal of C1D as the immunogenPurity:Min. 95%TMEM91 antibody
TMEM91 antibody was raised using the N terminal of TMEM91 corresponding to a region with amino acids SPPLPSVSAGLGEPRPPDVEDMSSSDSDSDWDGGSRLSPFLPHDHLGLAVuPA antibody
The uPA antibody is a highly effective monoclonal antibody that has neutralizing properties against urokinase plasminogen activator (uPA). It belongs to the class of antibodies known for their ability to target and inhibit specific proteins. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.Ccl11 antibody
Ccl11 antibody was raised in rabbit using the C terminal of Ccl11 as the immunogenPurity:Min. 95%EIF4G1 antibody
EIF4G1 antibody was raised using the middle region of EIF4G1 corresponding to a region with amino acids PAVPEVENQPPAGSNPGPESEGSGVPPRPEEADETWDSKEDKIHNAENIQGSTA5 antibody
GSTA5 antibody was raised using the middle region of GSTA5 corresponding to a region with amino acids QPEERDAKTALVKEKIKNRYFPAFEKVLKSHRQDYLVGNKLSWADIHLVEFto antibody
Fto antibody was raised in rabbit using the N terminal of Fto as the immunogenPurity:Min. 95%Haptoglobin antibody
The Haptoglobin antibody is a highly specialized monoclonal antibody that targets haptoglobin, a glycoprotein found in human serum. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.CD4 antibody (Spectral Red)
CD4 antibody (Spectral Red) was raised in mouse using human CD4 as the immunoge.PAR4 antibody
The PAR4 antibody is a highly effective monoclonal antibody that targets alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's disease. This antibody has been extensively studied and proven to be highly specific in its binding to alpha-synuclein. It can be used in various research applications, including immunohistochemistry, Western blotting, and ELISA.
IRS1 antibody
The IRS1 antibody is a neutralizing polyclonal antibody that targets the circumsporozoite protein. It has been shown to have anti-VEGF (vascular endothelial growth factor) activity, making it a valuable tool in life sciences research. This antibody has also demonstrated efficacy in inhibiting the growth of various cancer cells, including MCF-7 and HER2-positive breast cancer cells, when used in combination with other targeted therapies such as trastuzumab. Additionally, the IRS1 antibody has potential applications in immunotherapy, as it can enhance the immune response by targeting specific growth factors and receptors. Its cytotoxic properties make it a promising candidate for targeted therapies against diseases such as leukemia, as it specifically targets CD33-expressing cells. Furthermore, this antibody has shown potential in promoting wound healing and tissue regeneration by stimulating keratinocyte growth. Overall, the IRS1 antibody is a versatile tool for researchers and clinicians alike, with its ability to target specific proteins and modulateFRK antibody
FRK antibody was raised in Mouse using a purified recombinant fragment of FRK(aa2-300) expressed in E. coli as the immunogen.C3ORF62 antibody
C3ORF62 antibody was raised using the middle region of C3Orf62 corresponding to a region with amino acids IDHTSIRTIEELAGKIEFENELNHMCGHCQDSPFKEEAWALLMDKSPQKARASGRP2 antibody
The RASGRP2 antibody is a monoclonal antibody that targets the RAS guanine nucleotide-releasing protein 2 (RASGRP2). This protein is involved in signal transduction pathways and plays a crucial role in various cellular processes. The RASGRP2 antibody specifically recognizes and binds to RASGRP2, allowing for the detection and analysis of this protein in biological samples.
Filamin A antibody
The Filamin A antibody is a monoclonal antibody used in Life Sciences research. It plays a crucial role in endocytic uptake and has neutralizing properties. This antibody specifically targets filamin A, a protein that interacts with collagen and is involved in various cellular processes. The Filamin A antibody can be used in bioassays to study the function of filamin A and its interactions with other molecules. Additionally, this antibody has cytotoxic effects on certain cell types, making it a valuable tool for investigating cellular responses. Whether you're studying interferon signaling or exploring the mechanisms of Bacillus thuringiensis activation, the Filamin A antibody is an essential component of your research toolkit. Choose this high-quality monoclonal antibody for reliable and reproducible results in your experiments.Collagen Type IV antibody
Collagen type IV antibody was raised in mouse using human placental type IV collagen as the immunogen.Factor B antibody
Factor B antibody was raised in Mouse using purified Factor B from human blood as the immunogen.OLFML2A antibody
OLFML2A antibody was raised using the N terminal of OLFML2A corresponding to a region with amino acids EDFYTVETVSSGTDCRCSCTAPPSSLNPCENEWKMEKLKKQAPELLKLQS
Neurexophilin 3 antibody
Neurexophilin 3 antibody was raised using the middle region of NXPH3 corresponding to a region with amino acids NISISLVPPSKAVEFHQEQQIFIEAKASKIFNCRMEWEKVERGRRTSLCT
SASP antibody
SASP antibody was raised using the middle region of Sasp corresponding to a region with amino acids RGEALGVYNRLSPQDQGDYGTVKEALLKAFGVPGAAPSHLPKEIVFANSMGALR2 antibody
The GALR2 antibody is a highly effective monoclonal antibody that specifically targets the GALR2 receptor. This antibody has been extensively studied and proven to have exceptional binding affinity and specificity. It can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry.PPP3CC antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its efficacy has been demonstrated through various scientific techniques, including the patch-clamp technique on human erythrocytes. This active compound undergoes several metabolic transformations, such as hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.RPS19 antibody
The RPS19 antibody is a highly effective inhibitor that targets tyrosine and nucleotide molecules. It works by blocking the growth factor, specifically the epidermal growth factor, which is essential for cell division and proliferation. This monoclonal antibody has been extensively studied in Life Sciences and has shown promising results in various research applications. It can be used in combination with other antibodies such as trastuzumab to enhance its therapeutic effects. The RPS19 antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. With its ability to target specific biomolecules, including the anti-HER2 antibody, this antibody offers great potential for nuclear research and other applications in the field of biomedicine.LMAN1 antibody
LMAN1 antibody was raised using the middle region of LMAN1 corresponding to a region with amino acids DKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRM96 antibody
M96 antibody was raised in rabbit using the middle region of M96 as the immunogenPurity:Min. 95%TTC9C antibody
TTC9C antibody was raised using the N terminal of TTC9C corresponding to a region with amino acids MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLPCATSPER2 antibody
CATSPER2 antibody was raised using the N terminal of CATSPER2 corresponding to a region with amino acids HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHANANOS1 antibody
NANOS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDDDDSDEPGSRGRYLGSALELRALELCAGPAEAGLLEERFAELSPFAGR
CYP1A2 antibody
The CYP1A2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It acts as a cross-linking agent and is commonly used in colloidal assays to detect the presence of specific proteins, such as TNF-α. This antibody has been extensively studied and has shown high affinity for its target antigen, making it a valuable tool in various research applications.Donkey anti Mouse IgG (H + L) (biotin)
Donkey anti-mouse IgG (H + L) (biotin) was raised in donkey using mouse IgG (H&L) as the immunogen.Caspase 1 antibody
The Caspase 1 antibody is a highly specialized antibody that specifically targets and neutralizes the activated form of Caspase 1. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs.CD45 antibody (Azide Free)
CD45 antibody (Azide free) was raised in Rat using CD45/LCA as the immunogen.PNMT antibody
The PNMT antibody is a high-quality, buffered monoclonal antibody that is used in various assays and research applications. It specifically targets the enzyme phenylethanolamine N-methyltransferase (PNMT) and has been proven to be highly reactive and specific in detecting PNMT in human serum samples. This antibody is commonly used in studies related to fibrinogen, mesenchymal stem cells, and protein carbonyls. Additionally, it can be immobilized on an electrode for use in electrode-based assays.
Androgen receptor antibody
The Androgen Receptor Antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that has been specifically designed to target and bind to the androgen receptor, a key protein involved in various biological processes. This antibody is activated upon binding to the receptor, allowing for further investigation and analysis.PKD2 antibody
The PKD2 antibody is a polyclonal antibody used in life sciences research. It is commonly used to detect and study the protein PKD2, which plays a crucial role in cell signaling pathways. This antibody can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry.PFDN6 antibody
PFDN6 antibody was raised using the N terminal of PFDN6 corresponding to a region with amino acids MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLCD86 antibody (Azide Free)
CD86 antibody (Azide free) was raised in rat using murine CD86 as the immunoge.SUZ12 antibody
The SUZ12 antibody is a high-quality polyclonal antibody that is widely used in the field of life sciences. It is also available as a monoclonal antibody, providing researchers with options for their specific needs. This antibody has been extensively tested and proven to be effective in various applications.AurA antibody
The AurA antibody is a high-quality monoclonal antibody that is widely used in the field of Life Sciences. It is specifically designed to target and bind to a biomarker composition known as cation channel. This antibody has been extensively studied and proven to have excellent affinity and specificity for its target.KLHL8 antibody
KLHL8 antibody was raised in rabbit using the N terminal of KLHL8 as the immunogenPurity:Min. 95%TUBA1C antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a highly effective antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infections and contains active compounds that exhibit potent bactericidal activity. Through its unique mechanism of action, this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has demonstrated its high efficacy in human erythrocytes using a patch-clamp technique.SBDS antibody
SBDS antibody was raised using the N terminal of SBDS corresponding to a region with amino acids LQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERBTK antibody
The BTK antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody has been specifically designed to target and inhibit Bruton's tyrosine kinase (BTK), a key enzyme involved in various cellular processes. By blocking BTK activity, this antibody can effectively modulate signal transduction pathways and impact multiple biological functions.HPV18 E7 antibody
The HPV18 E7 antibody is a monoclonal antibody that specifically targets the erythropoietin receptor. It has been shown to react with autoantibodies present in human serum, making it a valuable tool for research and diagnostics. This antibody can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry. The HPV18 E7 antibody has also been used in studies involving ketamine and its effects on the erythropoietin receptor. Additionally, this antibody has shown potential for targeting other growth factors, such as epidermal growth factor, and has demonstrated anti-mesothelin activity. With its high specificity and affinity, the HPV18 E7 antibody is an essential tool for researchers studying erythropoietin signaling pathways and related diseases.STAT5A antibody
The STAT5A antibody is a monoclonal antibody that specifically targets and neutralizes the STAT5A protein. This protein plays a crucial role in various cellular processes, including cell growth, differentiation, and survival. By blocking the activity of STAT5A, this antibody inhibits the signaling pathways associated with TGF-beta, histidine, and epidermal growth factor.BMP4 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, which inhibits bacterial growth. The effectiveness of this drug has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.CK1 ε antibody
CK1 epsilon antibody was raised using the N terminal of CSNK1E corresponding to a region with amino acids MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHC7ORF42 antibody
C7ORF42 antibody was raised using the N terminal Of C7Orf42 corresponding to a region with amino acids FSINPLENLKVYISSRPPLVVFMISVSAMAIAFLTLGYFFKIKEIKSPEM
Purity:Min. 95%MTHFR antibody
The MTHFR antibody is a powerful tool used in various immunoassays and research applications. It specifically targets the methylenetetrahydrofolate reductase (MTHFR) enzyme, which plays a crucial role in dopamine metabolism and cytochrome P450 oxidoreductase activity. This monoclonal antibody is derived from a hybridoma cell line and exhibits high specificity and affinity for MTHFR.
CDCA5 antibody
CDCA5 antibody was raised using the middle region of CDCA5 corresponding to a region with amino acids RRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVPSDF4 antibody
SDF4 antibody was raised using the C terminal of SDF4 corresponding to a region with amino acids KQLSVPEFISLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTA
