Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75602 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Tyrosine Hydroxylase antibody
The Tyrosine Hydroxylase antibody is a cholinergic antibody commonly used in Life Sciences research. It is a polyclonal antibody that specifically targets tyrosine hydroxylase, an enzyme involved in the production of dopamine. This antibody has been extensively tested and validated for use in various applications, including immunohistochemistry and Western blotting.CAMK4 antibody
CAMK4 antibody is a monoclonal antibody that acts as an inhibitor of CAMK4, a protein kinase involved in various cellular processes. This antibody specifically targets CAMK4 and can be used in research studies to investigate its role in different biological pathways. Additionally, this antibody has been shown to have potential therapeutic applications in the treatment of diseases caused by Cryptosporidium infection and choroidal neovascularization. It can also be utilized in bioassays and assays related to androgen and steroid signaling. With its specificity and effectiveness, this CAMK4 antibody is a valuable tool for researchers in the field of Life Sciences studying oncogene homologs and nuclear proteins.Human Serum Albumin antibody
Human serum albumin antibody was raised in mouse using human serum albumin as the immunogen.Cytokeratin 18 antibody
The Cytokeratin 18 antibody is a specific antibody used in Life Sciences research. It is commonly used to detect and measure the levels of Cytokeratin 18, a protein that is found in epithelial cells. This antibody can be used in various applications such as immunohistochemistry, immunofluorescence, and Western blotting. It has been shown to have high affinity and specificity for Cytokeratin 18, making it a valuable tool for studying the function and expression of this protein. The Cytokeratin 18 antibody can also be used to study diseases such as cancer, where abnormal levels of Cytokeratin 18 may be present. Overall, this antibody is an essential tool for researchers working in the field of Life Sciences.CHRNA7 antibody
CHRNA7 antibody was raised in rabbit using the N terminal of CHRNA7 as the immunogenPurity:Min. 95%Rat anti Mouse IgG2a (biotin)
Rat anti-mouse IgG2a (biotin) was raised in rat using murine IgG as the immunogen.Purity:Min. 95%Molecular weight:0 g/molMHC Class II antibody (FITC)
MHC class II antibody (FITC) was raised in mouse using purified class II from JY cell line as the immunogen.Purity:Min. 95%Molecular weight:0 g/molBRCA1 antibody
The BRCA1 antibody is a mouse monoclonal antibody that specifically targets the BRCA1 protein. This protein is involved in DNA repair and plays a crucial role in preventing the development of certain types of cancer, particularly breast and ovarian cancer. The BRCA1 antibody has been extensively used in immunochemical studies to detect and quantify the presence of BRCA1 in various biological samples, including human serum, blood plasma, and tissue sections. It can be utilized in techniques such as immunohistochemistry, Western blotting, and ELISA. The high affinity and specificity of this monoclonal antibody make it an invaluable tool for researchers in the field of Life Sciences who are studying the functions and mechanisms of BRCA1.
Purity:Min. 95%NR1I3 antibody
NR1I3 antibody was raised using the middle region of NR1I3 corresponding to a region with amino acids PVFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDGIKB α antibody
The IKB alpha antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It has been extensively tested and validated for various applications, including flow assays, electrochemical impedance spectroscopy, and electrophoresis. This antibody specifically targets IKB alpha, which is a key regulator of the NF-κB signaling pathway.Purity:Min. 95%F4/80 Antibody
The F4/80 Antibody is a highly effective monoclonal antibody that targets the F4/80 protein, which is expressed on the surface of macrophages. This antibody has been extensively used in Life Sciences research to study various aspects of macrophage biology. It specifically binds to the F4/80 protein and can be used for immunofluorescence staining, flow cytometry analysis, and other applications.Purity:Min. 95%Donkey anti Goat IgG (H + L) (rhodamine)
This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.Purity:Min. 95%ZNF12 antibody
ZNF12 antibody was raised in rabbit using the N terminal of ZNF12 as the immunogenPurity:Min. 95%Rabbit anti Cat IgG (FITC)
Rabbit anti-cat IgG (FITC) was raised in rabbit using feline IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%VIM antibody
The VIM antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of interleukin-6 (IL-6), a key growth factor involved in various physiological processes. By inhibiting IL-6, the VIM antibody helps regulate immune responses and reduce inflammation. Additionally, this antibody has been shown to inhibit the production of superoxide, which plays a role in oxidative stress.
Purity:Min. 95%Goat anti Human IgG (Fc) (Agarose Conjugated)
Goat anti human IgG (Fc) (Agarose Conjugated) was raised in goat using human IgG Fc fragment as the immunogen.Purity:Min. 95%TYK2 antibody
The TYK2 antibody is a highly effective tool used in Life Sciences research. It is available as both polyclonal and monoclonal antibodies, allowing for versatility in various applications. The TYK2 antibody specifically targets the TYK2 protein kinase, which plays a crucial role in cellular signaling pathways.Purity:Min. 95%Neuroserpin antibody
The Neuroserpin antibody is a polyclonal antibody that has neutralizing properties against the enzyme collagenase. It can be used in various life sciences applications, including ultrasensitive detection and surface modification. The Neuroserpin antibody is specifically designed to bind to and inhibit the protease activity of collagenase. This specific binding allows for accurate and reliable measurement of collagenase levels using techniques such as electrochemical impedance spectroscopy. The use of this antibody on a carbon electrode enables the ultrasensitive detection of collagenase, making it an invaluable tool in research and diagnostic settings. Whether you're studying proteases or developing diagnostic assays, the Neuroserpin antibody offers high specificity and sensitivity for your experiments.Purity:Min. 95%HTR7 antibody
HTR7 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%Goat anti Cat IgG (H + L) (FITC)
Goat anti-feline IgG (H + L) (FITC) was raised in goat using feline IgG (H & L) as the immunogen.Purity:Min. 95%EGFR antibody
The EGFR antibody is a highly specialized monoclonal antibody used in life sciences research. It is designed to specifically target and neutralize the epidermal growth factor receptor (EGFR), an enzyme that plays a crucial role in cell growth and division. This cytotoxic antibody has been extensively tested for its efficacy and safety, making it a reliable tool for studying EGFR-related processes.
Purity:Min. 95%Mouse anti Rat IgG1
Mouse anti Rat IgG1 is a growth factor that plays a crucial role in various biological processes. It interacts with actin filaments and is involved in cell migration, adhesion, and contraction. This antibody specifically targets Rat IgG1 and can be used in research or diagnostic applications to detect or quantify Rat IgG1 levels. It can also be used as a secondary antibody in immunoassays when combined with primary antibodies targeting specific antigens of interest. Mouse anti Rat IgG1 has been widely used in life sciences research, particularly in the fields of immunology and molecular biology. Its high specificity and affinity make it an excellent tool for studying protein-protein interactions, signal transduction pathways, and cell signaling events. Whether you are conducting experiments or developing diagnostic assays, Mouse anti Rat IgG1 is an essential component for accurate and reliable results.Purity:Min. 95%GPR182 antibody
GPR182 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%Factor XIII antibody
Factor XIII antibody was raised in sheep using human Factor XIII purified from plasma as the immunogen.Purity:Min. 95%Substance P antibody
Substance P antibody was raised in guinea pig using duplicated N-Terminus of perilipin as the immunogen.Purity:Min. 95%Goat anti Rabbit IgG (H + L) (Texas Red)
Goat anti-rabbit IgG (H + L) was raised in goat using rabbit IgG, whole molecule as the immunogen.Purity:Min. 95%Donkey anti Goat IgG (H + L) (Alk Phos)
This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.Purity:Min. 95%Goat anti Human IgM mu chain (FITC)
Goat anti Human IgM mu chain secondary antibody (FITC) (mu chain specific)Purity:Min. 95%ZNF365 antibody
ZNF365 antibody was raised in rabbit using the N terminal of ZNF365 as the immunogenPurity:Min. 95%Keratin 8 antibody
The Keratin 8 antibody is a monoclonal antibody that specifically targets the EGF-like domain of Keratin 8, a basic protein found in human serum. This antibody is widely used in research and diagnostic applications to study the role of Keratin 8 in various diseases and conditions. It can be used as a standalone reagent or in combination with other antibodies, such as anti-CD20 antibodies, to develop cytotoxic conjugates for targeted therapy. The Keratin 8 antibody is highly specific and shows minimal cross-reactivity with other proteins, including serum albumin. Its high affinity and specificity make it an ideal tool for detecting and quantifying Keratin 8 levels in biological samples. Whether you are conducting basic research or developing diagnostic assays, the Keratin 8 antibody is a valuable resource for studying the functions of this important growth factor and its glycosylation patterns.Purity:Min. 95%Goat anti Rat IgG (Fab'2) (Texas Red)
Goat anti-rat IgG (Fab'2) was raised in goat using rat IgG F(c) fragment as the immunogen.Purity:Min. 95%GPR160 antibody
GPR160 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%Elk1 antibody
The Elk1 antibody is a polyclonal antibody that is commonly used in Life Sciences research. It specifically targets the Elk1 protein, which plays a crucial role in various cellular processes such as growth factor signaling and collagen synthesis. This antibody can be used for applications such as immunohistochemistry, western blotting, and flow cytometry.Purity:Min. 95%PSMC3IP antibody
PSMC3IP antibody was raised in rabbit using the middle region of PSMC3IP as the immunogenPurity:Min. 95%anti-Human NT-ProBNP Monoclonal
N-terminal pro B-type natriuretic peptide (NT-proBNP) is an inactive peptide released along with the active peptide hormone BNP when the walls of the heart are stretched or there is pressure overload on the heart by fluid overload.Purity:Min. 95%anti-Chicken IBDV Antibody Monoclonal
Infectious bronchitis virus (IBVD) is an acute, highly contagious upper respiratory tract disease in chickens
Purity:Min. 95%anti-Coronavirus (SARS-CoV-2) COVID Monoclonal
Monoclonal antibody raised against COVID (SARS-CoV-2) nucleoprotein.This product is intended for research and manufacturing uses only. It is not a diagnostic device. The user assumes all responsibility for care, custody and control of the material, including its disposal, in accordance with all regulations.Purity:Min. 95%CCIN antibody
Calicin antibody was raised in Guinea Pig using synthetic N-terminal domain of bovine calicin coupled to KLH as the immunogen.Purity:Min. 95%BIM antibody
The BIM antibody is a growth factor that belongs to the class of antibodies. It acts as an electrode by binding to specific targets, such as ornithine or epidermal growth factor. This monoclonal antibody has neutralizing properties and can inhibit the activity of interferon, collagen, IFN-gamma, vasoactive intestinal peptide, and TGF-beta. The BIM antibody is widely used in Life Sciences for various applications. Its high specificity and potency make it a valuable tool for research and therapeutic purposes.Purity:Min. 95%Goat anti Chicken IgG (H + L) (Texas Red)
Goat anti-chicken IgG (H+L) was raised in goat using chicken IgG whole molecule as the immunogen.Purity:Min. 95%PI3K antibody
The PI3K antibody is a powerful tool in the field of Life Sciences. It is used to study the role of phosphoinositide 3-kinase (PI3K) in various cellular processes, including cell growth, proliferation, and survival. This antibody specifically targets and binds to the activated form of PI3K, allowing researchers to analyze its function and activity.Purity:Min. 95%DPP7 antibody
DPP7 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%CCR4 antibody
CCR4 antibody was raised in rabbit using a synthetic peptide DTTQDETVYNSYYFYESMP-C corresponding to amino acid residues 8-26 of mouse CCR4 as the immunogen.Purity:Min. 95%Cofilin 1 antibody
The Cofilin 1 antibody is a polyclonal antibody that specifically targets cofilin 1, a protein involved in the regulation of actin dynamics. This antibody is widely used in life sciences research, particularly in the study of microvessel endothelial cells and their role in various physiological and pathological processes. It has been shown to be effective in detecting cofilin 1 expression levels and localization in different cell types and tissues.Purity:Min. 95%Donkey anti Rabbit IgG (H + L) (Texas Red)
Donkey anti-rabbit IgG (H+L) was raised in donkey using rabbit IgG whole molecule as the immunogen.
Purity:Min. 95%Donkey anti Rabbit IgG (H + L) (Texas Red)
Donkey anti-rabbit IgG (H+L) was raised in donkey using rabbit IgG whole molecule as the immunogen.
Purity:Min. 95%HIV1 p24 antibody
HIV1 p24 antibody was raised in goat using purified native p24 from strain IIIB as the immunogen.Purity:Min. 95%Goat anti Human Lambda Chain (Fab'2) (Texas Red)
Goat anti-human lambda chain (Fab'2) was raised in goat using human lambda light chain as the immunogen.Purity:Min. 95%Goat anti Rabbit IgG (H + L) (HRP)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Purity:Min. 95%NMDAR1 antibody
NMDAR1 antibody is a protein antibody that specifically targets the N-methyl-D-aspartate receptor subunit 1 (NMDAR1). This antibody plays a crucial role in regulating neuronal activity and synaptic plasticity. It has been shown to interact with various growth factors, such as erythropoietin and epidermal growth factor, as well as fatty acids and natriuretic peptides. The NMDAR1 antibody can be used for research purposes, particularly in studies involving neuronal signaling pathways and neurodegenerative diseases. Whether you're conducting experiments or analyzing data, this monoclonal antibody is an essential tool for any neuroscience laboratory. With its high specificity and affinity, it ensures accurate results and reliable data interpretation. Trust the NMDAR1 antibody to provide valuable insights into the intricate workings of the brain.
Purity:Min. 95%MDM4 antibody
MDM4 antibody was raised in rabbit using the N terminal of MDM4 as the immunogenPurity:Min. 95%ATF2 antibody
The ATF2 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets ATF2, a transcription factor that plays a crucial role in regulating gene expression. This antibody has been shown to have neutralizing effects on ATF2, inhibiting its activity and preventing it from binding to DNA. Additionally, the ATF2 antibody has been found to have therapeutic potential in the treatment of various diseases, including cancer and autoimmune disorders. It has been shown to inhibit the growth of collagen-producing cells and suppress the production of multidrug resistance proteins. Furthermore, studies have demonstrated that the ATF2 antibody can block the activity of alpha-fetoprotein and urokinase plasminogen activator, both of which are involved in tumor progression and metastasis. This monoclonal antibody has also been found to modulate tyrosine kinase signaling pathways and inhibit the growth factor-induced cell proliferation. In addition to its therapeutic applications, the ATF2 antibody is widely used as a research tool for studyingPurity:Min. 95%Donkey anti Goat IgG (H + L) (Alk Phos)
Donkey anti-goat IgG (H+L) (Alk Phos) was raised in donkey using goat IgG whole molecule as the immunogen.Purity:Min. 95%MAFK antibody
MAFK antibody was raised in rabbit using the N terminal of MAFK as the immunogen
Purity:Min. 95%Rabbit anti Chicken IgG/Y (H + L) (HRP)
This antibody reacts with heavy chains on chicken IgG (IgY) and light chains on all chicken immunoglobulins.Purity:Min. 95%IKB alpha antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. The potency of this drug has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.Purity:Min. 95%NFKB p65 antibody
The NFKB p65 antibody is a glycoprotein that belongs to the class of chemokines. It plays a crucial role in regulating immune responses and inflammation. This monoclonal antibody specifically targets the p65 subunit of the nuclear factor kappa B (NFKB) complex, which is involved in the transcriptional regulation of numerous genes associated with immune and inflammatory responses.
Purity:Min. 95%Goat anti Human kappa chain (FITC)
This antibody reacts with kappa light chains on human immunoglobulins.Purity:Min. 95%Sheep anti Rabbit IgG (H + L) (FITC)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Purity:Min. 95%Ethyl Glucuronide antibody
The Ethyl Glucuronide antibody is a highly specialized product used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and detects Ethyl Glucuronide (EtG), a metabolite of ethanol. This antibody is produced by hybridoma cells and has been extensively tested for its specificity and sensitivity.Purity:Min. 95%Cortactin antibody
The Cortactin antibody is a highly specialized product in the field of Life Sciences. It is an acidic growth factor that plays a crucial role in cellular processes such as cell migration, adhesion, and invasion. This Polyclonal Antibody specifically targets the activated form of Cortactin and can be used for various applications including immunoassays, western blotting, and immunofluorescence.Purity:Min. 95%Rabbit anti Human IgG (H + L) (Alk Phos)
Rabbit anti-human IgG (H+L) (Alk Phos) was raised in rabbit using human IgG whole molecule as the immunogen.Purity:Min. 95%KIAA0737 antibody
KIAA0737 antibody was raised in rabbit using the N terminal of KIAA0737 as the immunogenPurity:Min. 95%Goat anti Human IgG + IgA + IgM (HRP)
This antibody reacts with heavy chains on human IgA + IgG + IgM and light chains on all human immunoglobulins.Purity:Min. 95%Haloperidol antibody
The Haloperidol antibody is a nuclear monoclonal antibody that targets the tyrosine protein complex. It has been specifically designed to neutralize the effects of Haloperidol, a commonly used antipsychotic medication. This antibody binds to the target protein, preventing its interaction with other molecules and inhibiting its activity. The Haloperidol antibody has been extensively tested and validated for use in various applications, including research in life sciences. It is produced using high-quality excipients and inhibitors to ensure stability and efficacy. Additionally, this antibody has shown promising results in studies involving insulin-like growth factor binding proteins, fibronectin, collagen, and low-density lipoprotein receptors. With its specificity and reliability, the Haloperidol antibody is a valuable tool for researchers in the field of multidrug therapy.Purity:Min. 95%Donkey anti Rat IgG (H + L) (rhodamine)
This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.Purity:Min. 95%Capsaicin Receptor antibody
Capsaicin Receptor antibody was raised in rabbit using synthetic peptide from the C-terminus of the capsaicin receptor conjugated to BSA as the immunogen.Purity:Min. 95%Goat anti Human IgG (H + L) (biotin)
This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.
Purity:Min. 95%Rabbit anti Rat IgG (Texas Red)
Rabbit anti-rat IgG was raised in rabbit using rat IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%Frizzled antibody
Frizzled antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%BRS3 antibody
BRS3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%Factor XI antibody
Factor XI antibody was raised in goat using human Factor XI purified from plasma as the immunogen.Purity:Min. 95%GPR182 antibody
GPR182 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%Rabbit anti Sheep IgG (Texas Red)
Rabbit anti-sheep IgG was raised in rabbit using sheep IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%Rabbit anti Sheep IgG (H + L)
Rabbit anti-sheep IgG (H+L) was raised in rabbit using sheep IgG whole molecule as the immunogen.Purity:Min. 95%Donkey anti Goat IgG (H + L) (Alk Phos)
Donkey anti Goat IgG (H + L) secondary antibody (Alk phos)Purity:Min. 95%Goat anti Donkey IgG (H + L) (rhodamine)
This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.Purity:Min. 95%Attractin antibody
Attractin antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%BAD antibody
The BAD antibody is a nuclear hormone peptide that is used in recombination studies. It is available as both a monoclonal and polyclonal antibody. This antibody specifically targets glycopeptides, glycoproteins, and glycans, making it an effective anti-connexin agent. The BAD antibody has neutralizing properties and has been shown to be neuroprotective. Its ability to target specific glycosylation patterns makes it a valuable tool in studying the role of antibodies in various biological processes. Additionally, the BAD antibody is colloidal in nature, allowing for easy dispersion and application in research settings.Purity:Min. 95%Mouse RBC antibody
Mouse RBC antibody was raised in rabbit using murine erythrocytes as the immunogen.Purity:Min. 95%Chicken anti Rat IgG (H + L) (Alk Phos)
This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.Purity:Min. 95%p53 antibody
The p53 antibody is a highly sought-after product in the field of Life Sciences. It is an antibody that specifically targets and binds to the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. This monoclonal antibody has been extensively tested and validated for its specificity and sensitivity in detecting p53 protein expression in human serum samples.Purity:Min. 95%ESRRG antibody
ESRRG antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%Mouse anti Rat IgD (FITC)
Mouse anti-rat IgD (FITC) was raised in mouse using rat IgD as the immunogen.Purity:Min. 95%Molecular weight:0 g/molChicken anti Goat IgG (H + L) (FITC)
This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.Purity:Min. 95%Rabbit anti Dog IgG (FITC)
Rabbit anti-dog IgG (FITC) was raised in rabbit using canine IgG F(c) fragment as the immunogen.Purity:Min. 95%VIP antibody
Vasoactive Intestinal Peptide antibody was raised in rabbit using purified porcine VIP as the immunogen.Purity:Min. 95%Hepatitis C virus antibody
Hepatitis C virus antibody was raised in goat using recombinant NS4 (genotype 1a) as the immunogen.Purity:Min. 95%ZNF488 antibody
ZNF488 antibody was raised in rabbit using the C terminal of ZNF488 as the immunogenPurity:Min. 95%Rabbit anti Dog IgG (H + L) (Texas Red)
Rabbit anti-dog IgG (H+L) was raised in rabbit using canine IgG whole molecule as the immunogen.Purity:Min. 95%Rabbit anti Goat IgG (H + L) (FITC)
This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.Purity:Min. 95%Goat anti Rat IgM (biotin)
Goat anti-rat IgM (biotin) was raised in goat using rat IgM mu chain as the immunogen.
Purity:Min. 95%Perforin antibody (PE)
Perforin antibody (PE) was raised in mouse using purified granules from human YT lymphoma cell line as the immunogen.Purity:Min. 95%Molecular weight:0 g/molTroponin I antibody (Skeletal Muscle) (biotin)
Troponin I antibody (skeletal Muscle) was raised in mouse using human skTnI as the immunogen.Purity:Min. 95%Molecular weight:0 g/molGoat anti Rat IgG (H + L) (HRP)
Goat anti-rat IgG (H+L) (HRP) was raised in goat using rat IgG whole molecule as the immunogen.Purity:Min. 95%AKT1 antibody
AKT1 antibody was raised in rabbit using the N terminal of AKT1 as the immunogen
Purity:Min. 95%Goat anti Mouse IgM (Fab'2) (PE)
Goat anti-mouse IgM (Fab'2) (PE) was raised in goat using murine IgM mu heavy chain as the immunogen.Purity:Min. 95%ZNF527 antibody
ZNF527 antibody was raised in rabbit using the C terminal of ZNF527 as the immunogenPurity:Min. 95%AHR antibody
AHR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%Goat anti Human IgG (biotin)
Goat anti-human IgG (biotin) was raised in goat using human IgG F(c) fragment as the immunogen.Purity:Min. 95%SLC5A3 antibody
SLC5A3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%Rabbit anti Mouse IgM (biotin)
Rabbit anti-mouse IgM (biotin) was raised in rabbit using murine IgM mu heavy chain as the immunogen.Purity:Min. 95%Basic hair keratin K86 antibody
basic hair keratin K86 antibody was raised in Guinea Pig using synthetic peptide of human basic hair (trichocytic) keratin K86 coupled to KLH as the immunogen.Purity:Min. 95%Staphylococcus aureus antibody
Staphylococcus aureus antibody was raised in rabbit using ATCC 27660 as the immunogen.Purity:Min. 95%RELB antibody
RELB antibody was raised in rabbit using the middle region of RELB as the immunogen
Purity:Min. 95%Goat anti Rabbit IgG (H + L)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Purity:Min. 95%Nav1.6 antibody
The Nav1.6 antibody is a highly specific monoclonal antibody that targets the Nav1.6 antigen, a key protein involved in neuronal signaling. This antibody has been extensively studied for its role in regulating the activity of Nav1.6 channels, which are essential for proper nerve function.Purity:Min. 95%GRM5 antibody
GRM5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%Rabbit anti Sheep IgG (H + L)
Rabbit anti-sheep IgG (H+L) was raised in rabbit using sheep IgG whole molecule as the immunogen.Purity:Min. 95%Durvalumab
CAS:Durvalumab is a human immunoglobulin G1 (IgG1) monoclonal antibody that binds to PD-L1, a protein expressed on the surface of tumor cells. Durvalumab is being studied in combination with tremelimumab (another anti-PD-L1 antibody) for use as an antitumor agent. The combination of durvalumab and tremelimumab has been shown to have an antitumor response in mice with bowel disease. This drug has been shown to have an immune-modulating effect in combination therapy groups.Purity:Min. 95%Color and Shape:PowderMolecular weight:1,000 g/molIRS1 antibody
The IRS1 antibody is a monoclonal antibody that targets the insulin receptor substrate 1 (IRS1) protein. This protein plays a crucial role in mediating the effects of various growth factors and cytokines, such as interleukin-6. The IRS1 antibody specifically recognizes and binds to the IRS1 protein, inhibiting its signaling pathway and preventing downstream cellular responses.Purity:Min. 95%HTR1E antibody
HTR1E antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%MLDP antibody
MLDP antibody was raised in Guinea Pig using synthetic peptide C-terminal aa 451-463 of human MLDP as the immunogen.Purity:Min. 95%Rabbit anti Bovine IgG (H + L) (HRP)
Rabbit anti-bovine IgG (H+L) (HRP) was raised in rabbit using bovine IgG whole molecule as the immunogen.Purity:Min. 95%CYSLTR2 antibody
CYSLTR2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%Cingulin antibody
Cingulin antibody was raised in Guinea Pig using Full length GST-fusion protein of human cingulin as the immunogen.Purity:Min. 95%Rabbit anti Mouse IgG2b (biotin)
Rabbit anti-mouse IgG2b (biotin) was raised in rabbit using murine IgG2b heavy chain as the immunogen.Purity:Min. 95%Goat anti Human IgG (FITC)
This antibody reacts with heavy chains on human IgG (gamma chain).Purity:Min. 95%Rabbit anti Human IgG (H + L) (Alk Phos)
This antibody reacts with heavy (gamma) chains on human IgG and light chains on all human immunoglobulins.Purity:Min. 95%SFPI1 antibody
SFPI1 antibody was raised in rabbit using the N terminal of SFPI1 as the immunogenPurity:Min. 95%TrkA antibody
TrkA antibody was raised in rabbit using recombinant protein corresponding to extracellular domain of rat TrkA receptor as the immunogen.Purity:Min. 95%Goat anti Rabbit IgG (H + L) (biotin)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Purity:Min. 95%Rabbit anti Goat IgG (Alk Phos)
Rabbit anti-goat IgG (Alk Phos) was raised in rabbit using goat IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%Rabbit anti Sheep IgG (H + L) (rhodamine)
Rabbit anti-sheep IgG (H+L) (Rhodamine) was raised in rabbit using sheep IgG whole molecule as the immunogen.Purity:Min. 95%Acidic hair keratin K36 antibody
acidic hair keratin K36 antibody was raised in Guinea Pig using synthetic peptide of human acidic hair (trichocytic) keratin K36 coupled to KLH as the immunogen.Purity:Min. 95%IFN β antibody
IFN beta antibody was raised in rabbit using mouse interferon beta as the immunogen.Purity:Min. 95%JAK1 antibody
The JAK1 antibody is a highly specialized monoclonal antibody that targets the Janus kinase 1 (JAK1) protein. This glycoprotein plays a crucial role in cell signaling pathways, particularly those involved in endothelial growth and development. By neutralizing the activity of JAK1, this antibody effectively inhibits the growth factor signaling cascade, preventing excessive cell proliferation.Purity:Min. 95%UCHL3 antibody
UCHL3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%Donkey anti Mouse IgG (H + L)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.Purity:Min. 95%Goat anti Mouse IgG (H + L) (Alk Phos)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.Purity:Min. 95%DUSP23 antibody
DUSP23 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%SPHK1 antibody
SPHK1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%AMPK alpha antibody
The AMPK alpha antibody is a polyclonal antibody that is used in various assays and bioassays in the field of Life Sciences. It specifically targets connexin, a protein involved in cell communication. The antibody can be used to detect autoantibodies or to study the expression and localization of connexin in different tissues or cell types. This high-quality antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific needs. With its high specificity and sensitivity, this antibody is a valuable tool for studying the role of connexin and its associated pathways, such as protein kinase signaling. Its excellent performance in various applications makes it an essential component in research related to helicobacter infections, phosphocholine metabolism, and colloidal microsphere studies.Purity:Min. 95%Myc antibody
The Myc antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of Antibodies and is used for various applications. This antibody specifically targets vasoactive intestinal peptide (VIP), interferon, acidic, macrophage colony-stimulating factor (M-CSF), activated glutamate, colony-stimulating factor (CSF), alpha-fetoprotein, human serum, IFN-gamma, phosphatase, and other related factors.Purity:Min. 95%Goat anti Rabbit IgG (HRP)
Goat anti-rabbit IgG (HRP) was raised in goat using rabbit IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%Rat PMN antibody
Rat PMN antibody was raised in rabbit using rat PMNs as the immunogen.Purity:Min. 95%ASK1 antibody
The ASK1 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets and neutralizes the activity of apoptosis signal-regulating kinase 1 (ASK1). ASK1 plays a crucial role in various cellular processes, including cell growth, differentiation, and apoptosis. By blocking the activity of ASK1, this antibody can provide valuable insights into the molecular mechanisms underlying these processes.
Purity:Min. 95%Sheep RBC antibody
Sheep RBC antibody was raised in rabbit using ovine erythrocytes as the immunogen.Purity:Min. 95%Keratin K20 antibody (FITC)
Keratin K20 antibody (FITC) was raised in mouse using electrophoretically purified keratin K20 from human intestinal mucosa as the immunogen.Purity:Min. 95%Molecular weight:0 g/molMetallophilic Macrophage antibody (biotin)
Metallophilic macrophage antibody (biotin) was raised in rat using mouse Lymph node stroma as the immunogen.Purity:Min. 95%Goat anti Human IgG (H + L) (Alk Phos)
Goat anti-Human IgG (H + L) (Alk Phos) was raised in goat using purified Human IgG (H&L) as the immunogen.Purity:Min. 95%Tau antibody
The Tau antibody is a highly specialized monoclonal antibody that targets and binds to tau proteins in the brain. Tau proteins play a crucial role in stabilizing microtubules, which are responsible for maintaining the structure and function of neurons. However, in neurodegenerative diseases such as Alzheimer's, tau proteins become abnormally phosphorylated and form tangles, leading to neuronal dysfunction and cognitive decline.Purity:Min. 95%Glucagon antibody
Glucagon antibody was raised in rabbit using Porcine pancreatic glucagon/BSA as the immunogen.Purity:Min. 95%CDK6 antibody
CDK6 antibody is a monoclonal antibody that specifically targets the cyclin-dependent kinase 6 (CDK6) protein. CDK6 plays a crucial role in cell cycle regulation and is involved in various cellular processes, including cell growth and differentiation. This antibody binds to CDK6 and inhibits its activity, preventing the phosphorylation of target proteins.Purity:Min. 95%HDAC5 antibody
The HDAC5 antibody is a monoclonal antibody that specifically targets and binds to histone deacetylase 5 (HDAC5). HDAC5 is an enzyme involved in the regulation of gene expression by modifying the acetylation status of histones. This antibody has been extensively used in research related to chemokines, growth factors, and pleural fluid analysis. It has been proven to be highly specific and sensitive in detecting HDAC5 in various experimental settings.
Purity:Min. 95%Goat anti Rabbit IgG (H + L) (FITC)
Goat anti-rabbit IgG (H+L) (FITC) was raised in goat using rabbit IgG, whole molecule as the immunogen.Purity:Min. 95%Akt2 antibody
The Akt2 antibody is a highly specialized antibody that has neutralizing properties against the Akt2 protein, which is a key regulator of cell growth and survival. This antibody can effectively block the activity of Akt2, thereby inhibiting its downstream signaling pathways. The Akt2 antibody has been extensively studied in various research fields, including cancer biology, immunology, and molecular biology. It has shown promising results in inhibiting the growth of tumor cells and enhancing the cytotoxic effects of chemotherapeutic drugs such as sorafenib and doxorubicin. Additionally, this antibody has been used in studies involving mycoplasma genitalium infections and has shown potential for therapeutic applications in this area. With its high specificity and potency, the Akt2 antibody is an invaluable tool for researchers in the life sciences field who are studying growth factors, cytokines, and other signaling molecules involved in cellular processes.Purity:Min. 95%GPR20 antibody
GPR20 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%p53 antibody
The p53 antibody is a polyclonal antibody that is used in Life Sciences research. It is designed to target and bind to the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. The antibody can be used in various applications, such as immunohistochemistry, western blotting, and flow cytometry.Purity:Min. 95%Goat anti Human IgM (mu chain) (HRP)
This antibody reacts with heavy chains on human IgM (mu chain).Purity:Min. 95%Rabbit anti Bovine IgG (H + L)
Rabbit anti-bovine IgG (H+L) was raised in rabbit using bovine IgG, whole molecule as the immunogen.Purity:Min. 95%beta Catenin antibody
The beta Catenin antibody is a protein that specifically targets and binds to β-catenin, a key protein involved in cell adhesion and signaling pathways. This monoclonal antibody is widely used in research and clinical applications to study the role of β-catenin in various biological processes.Purity:Min. 95%Mouse Brain antibody
Mouse brain antibody was raised in rabbit using brain tissue from C3H mice as the immunogen.Purity:Min. 95%Goat anti Human IgG (H + L) (rhodamine)
Goat anti-human IgG (H+L) (Rhodamine) was raised in goat using human IgG whole molecule as the immunogen.Purity:Min. 95%Transferrin antibody
Transferrin antibody was raised in goat using Isolated by affinity chromatography using antigen coupled to agarose beads. as the immunogen.
Haptoglobin antibody
Haptoglobin antibody was raised in goat using purified human haptoglobin as the immunogen.
ApoC-II antibody
ApoC-II antibody was raised in goat using synthetic, full-length apolipoprotein type C-II as the immunogen.
ApoC-III antibody
ApoC-III antibody was raised in goat using produced from apolipoprotein type C-III derived from human plasma as the immunogen.
HER2 antibody
The HER2 antibody is a highly specialized antibody used in the field of Life Sciences. It can be either a polyclonal or monoclonal antibody, designed to target the HER2 protein molecule. This protein is found on the surface of certain cancer cells and is associated with aggressive tumor growth.Purity:Min. 95%Goat anti Human IgE (ε chain) (FITC)
This antibody reacts with heavy chains on human IgE (epsilon chain).Purity:Min. 95%Donkey anti Goat IgG (H + L) (FITC)
Donkey anti-goat IgG (H+L) (FITC) was raised in donkey using goat IgG, whole molecule as the immunogen.Purity:Min. 95%Goat anti Rabbit IgG (H + L) (FITC)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Purity:Min. 95%
