Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75602 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
CD106 antibody
The CD106 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to bind to the CD106 antigen, a cell surface protein involved in various immune responses and inflammation processes. This mouse monoclonal antibody has been extensively tested and validated for its high affinity and specificity in peptide binding assays.EXOSC10 antibody
EXOSC10 antibody was raised using the middle region of EXOSC10 corresponding to a region with amino acids ACKAAAEQAISVRQQVVLENAAKKRERATSDPRTTEQKQEKKRLKISKKP
RBM9 antibody
RBM9 antibody was raised using the middle region of RBM9 corresponding to a region with amino acids TAAAAAAAAYSDGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAPVPS54 antibody
VPS54 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYLPQISKEHFTVYQQEISQREKIHERCKNICPPKDTFERTLLHTHDKSRTIGD4 antibody
TIGD4 antibody was raised using the N terminal of TIGD4 corresponding to a region with amino acids RFDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVPVNGPMLRLKANDFAQKDHX9 antibody
DHX9 antibody was raised in mouse using recombinant Human Deah (Asp-Glu-Ala-His) Box Polypeptide 9 (Dhx9)DDX3 antibody
The DDX3 antibody is a monoclonal antibody that specifically targets the DDX3 protein. It has been widely used in life sciences research to study various biological processes, including receptor binding, antigen binding, and protein-protein interactions. The DDX3 antibody can also be used as a diagnostic tool for detecting the presence of DDX3 in samples.GST antibody
The GST antibody is a monoclonal antibody that specifically targets glutathione S-transferase (GST). It is widely used in life sciences research and various assays. This antibody can be used to detect the presence of GST in samples, making it a valuable tool for studying the role of GST in cellular processes. Additionally, the GST antibody has been shown to have cytotoxic effects on cancer cells expressing annexin A2, suggesting its potential as a therapeutic agent. With its high specificity and sensitivity, this antibody is an essential component for researchers studying insulin and glucagon signaling pathways, as well as other areas of interest in the field of life sciences.Connexin 43 antibody
The Connexin 43 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to Connexin 43, a protein involved in cell-to-cell communication. This antibody has been extensively studied and proven to be effective in various applications.PROM2 antibody
The PROM2 antibody is a highly specialized monoclonal antibody that targets the collagen protein. It has been extensively studied in the field of Life Sciences for its role in various biological processes. This antibody specifically recognizes and binds to PROM2, a protein that is involved in the regulation of alpha-fetoprotein, globulin, and albumin levels.HAO1 antibody
The HAO1 antibody is a nuclear autoantibody that belongs to the class of Monoclonal Antibodies. It specifically targets the octanoyltransferase and methyl transferase enzymes, which are involved in high-flux metabolic pathways. This antibody has been extensively studied as a biomarker for various diseases and conditions, including interleukin disorders and carnitine deficiencies. The HAO1 antibody is used in research and diagnostic assays to detect the presence of these enzymes and their inhibitors. Its high specificity and sensitivity make it an essential tool in the field of Life Sciences.CACNA1I antibody
CACNA1I antibody was raised using the middle region of CACNA1I corresponding to a region with amino acids LRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWASGlucagon antibody
The Glucagon antibody is a monoclonal antibody that has been developed for use in bioassays and immunoassays. It specifically targets the antigen binding domain of lipoprotein lipase, an enzyme involved in lipid metabolism. This monoclonal antibody is highly reactive and has been extensively studied in Life Sciences research.KRR1 antibody
KRR1 antibody was raised using the C terminal of KRR1 corresponding to a region with amino acids KANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETPSMA3 antibody
PSMA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids TCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREE
HSP40 antibody
The HSP40 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to Heat Shock Protein 40 (HSP40), a protein involved in cellular processes such as protein folding and transportation. This antibody recognizes the amino group of HSP40 and can be used for various applications, including immunohistochemistry, Western blotting, and ELISA.RBM26 antibody
RBM26 antibody was raised using the middle region of RBM26 corresponding to a region with amino acids PAALKAAQKTLLVSTSAVDNNEAQKKKQEALKLQQDVRKRKQEILEKHIEApoA1 antibody
The ApoA1 antibody is a monoclonal antibody that plays a crucial role in Life Sciences. It specifically targets and interacts with Apolipoprotein A1 (ApoA1), which is a major component of high-density lipoprotein (HDL) particles. This antibody has been extensively studied for its potential therapeutic applications in various diseases, including cardiovascular disorders.SRR antibody
The SRR antibody is a monoclonal antibody that is specifically designed for the detection and neutralization of insulin. It is commonly used in research and clinical settings to study hyperinsulinaemic hypoglycaemia, a condition characterized by abnormally high levels of insulin in the blood. The SRR antibody is produced through chemical synthesis or recombinant technology using human insulin as the antigen. It has been extensively validated using techniques such as polymerase chain reaction (PCR) and racemase assays to ensure its specificity and reliability. This monoclonal antibody can be used to detect insulin in various samples, including serum, plasma, and tissue extracts. Additionally, it has been shown to have neutralizing activity against insulin, making it a valuable tool for studying the effects of insulin antibodies and autoantibodies in human insulin preparations. With its high affinity for insulin and ability to recognize specific amino acid residues, the SRR antibody offers precise and accurate results for insulin-related research applications.V5 Tag antibody
The V5 Tag antibody is a highly reactive monoclonal antibody that is used in the field of Life Sciences. It specifically targets the V5 epitope tag, which is commonly used in protein research and expression studies. This antibody can be used for various applications such as immunoblotting, immunoprecipitation, and immunofluorescence assays.FGF2 antibody
The FGF2 antibody is a monoclonal antibody that specifically targets and neutralizes fibroblast growth factor 2 (FGF2). It is an ultrasensitive detection tool used in various immunoassays for the detection and quantification of FGF2. This antibody works by binding to FGF2, preventing its interaction with cell surface receptors and inhibiting its signaling pathways. By blocking FGF2 activity, the antibody can inhibit processes such as cell proliferation, angiogenesis, and wound healing that are regulated by FGF2. The FGF2 antibody is widely used in life sciences research, including studies on cancer, cardiovascular diseases, and tissue regeneration. Its high specificity and cytotoxic effects make it an invaluable tool for understanding the role of FGF2 in various biological processes.EMA antibody
The EMA antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to fibrinogen, a glycoprotein involved in blood clotting. This antibody is produced using hybridoma cell lines, which are created by fusing immune cells with tumor cells. The resulting hybridoma cells have the ability to produce large quantities of the EMA antibody.APPL1 antibody
The APPL1 antibody is a highly specific and potent antibody that can be used for various applications in research and diagnostics. It is available as both polyclonal and monoclonal antibodies, providing flexibility for different experimental needs.DHX30 antibody
DHX30 antibody was raised using a synthetic peptide corresponding to a region with amino acids AESGMAPGGPGEGDGSLVNASRDLLKEFPQPKNLLNSVIGRALGISHAKDAPOM antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. Through extensive research using transcription-quantitative polymerase chain and patch-clamp techniques, it has been proven to inhibit bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Additionally, this drug undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It also demonstrates a high affinity for markers expressed in Mycobacterium tuberculosis strains, inhibiting their cell growth. Experience the potent efficacy of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside in combating tuberculosis infections.
CBFA2T2 antibody
CBFA2T2 antibody was raised in mouse using recombinant Core-Binding Factor,Alpha Subunit 2SMAD2 antibody
The SMAD2 antibody is a highly effective tool in the field of Life Sciences. It is an antibody that specifically targets SMAD2, a protein involved in various cellular processes. This antibody has been extensively studied and has shown to have potent protease activity, making it an ideal choice for researchers working on protease-related projects.C6 antibody
The C6 antibody is a highly activated protein that acts as an inhibitor of tumor necrosis factor-alpha (TNF-α). It is widely used in Life Sciences research for its ability to target and neutralize TNF-α, a key player in inflammation and immune response. The C6 antibody has shown promising results in various studies, including its ability to inhibit the binding of TNF-α to its receptors and reduce the production of inflammatory mediators.USP5 antibody
The USP5 antibody is a highly specialized product in the field of Life Sciences. It belongs to the class of neutralizing monoclonal antibodies that target TGF-beta protein. This antibody is specifically designed to bind to and neutralize TGF-beta, a growth factor involved in various cellular processes.RBP1 antibody
The RBP1 antibody is a growth factor that has been shown to play a role in thrombocytopenia. It is commonly used in Life Sciences research and can be utilized in various experimental techniques, such as electrode-based assays. This trifunctional antibody is capable of binding to human serum and activating specific pathways. It can also be used as a tool for the detection and quantification of other antibodies or antigens. The RBP1 antibody has genotoxic effects on cells, making it useful for studying DNA damage and repair mechanisms. Additionally, it acts as an inhibitor of phosphatase activity and chemokine signaling. This Monoclonal Antibody specifically targets tyrosine kinase receptors and protein kinases, making it an essential tool for researchers in the field of molecular biology.
CNP antibody
CNP antibody was raised using the middle region of CNP corresponding to a region with amino acids LYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTIILOX antibody
The LOX antibody is a low-molecular-weight monoclonal antibody with immunosuppressant properties. It contains a cycloalkyl group that specifically targets lipoprotein lipase, an enzyme involved in lipid metabolism. This antibody has the ability to neutralize interferon and other growth factors, making it an effective antiviral agent. Additionally, the LOX antibody has been shown to have a high affinity for alpha-fetoprotein, a marker commonly found in certain types of cancer cells. With its neutralizing capabilities and targeted approach, this monoclonal antibody is a valuable tool in the field of life sciences and holds great potential for therapeutic applications.
KIF4A antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Additionally, it has been proven to have high efficacy in human erythrocytes using a patch-clamp technique. The metabolism of this drug involves various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.SDSL antibody
SDSL antibody was raised using the N terminal of SDSL corresponding to a region with amino acids MDGPVAEHAKQEPFHVVTPLLESWALSQVAGMPVFLKCENVQPSGSFKIRGUK1 antibody
GUK1 antibody was raised using the middle region of GUK1 corresponding to a region with amino acids IEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYILONRF3 antibody
LONRF3 antibody was raised using the middle region of LONRF3 corresponding to a region with amino acids LEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIEDQKVQGKIF22 antibody
KIF22 antibody was raised in mouse using recombinant Human Kinesin Family Member 22 (Kif22)
RHBDD1 antibody
The RHBDD1 antibody is a monoclonal antibody specifically designed to target insulin. It is commonly used in research and diagnostic applications for the detection and analysis of insulin levels. This antibody has been extensively validated using mass spectrometry methods and has shown high specificity and sensitivity in detecting insulin in various samples, including human serum. The RHBDD1 antibody is derived from a hybridoma cell line and is produced using recombinant human insulin as an antigen. Its unique binding properties enable accurate measurement of insulin levels, making it an essential tool in the field of Life Sciences. Whether you are studying hyperinsulinaemic hypoglycaemia or investigating insulin-related disorders, this mouse monoclonal antibody can provide reliable results. With its ability to recognize specific acid residues on insulin, the RHBDD1 antibody offers precise and consistent performance for insulin detection. Trust this high-quality antibody for your research needs and unlock new insights into the role of insulin in various physiological processes.ZNF19 antibody
ZNF19 antibody was raised using the N terminal of ZNF19 corresponding to a region with amino acids TALGYPVPKPALISLLERGDMAWGLEAQDDPPAERTKNVCKDVETNIDSENGAL antibody
The NGAL antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is commonly employed in transfer reactions and immunoassays to detect and quantify NGAL (neutrophil gelatinase-associated lipocalin) levels in various biological samples. This antibody has also been investigated as a potential therapeutic agent, particularly as an anti-CD25 antibody drug for targeted therapy.NR4A3 antibody
NR4A3 antibody was raised using the middle region of NR4A3 corresponding to a region with amino acids KCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMN
UBE2L3 antibody
UBE2L3 antibody was raised using the middle region of UBE2L3 corresponding to a region with amino acids WQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQNSMCE1 antibody
NSMCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKEAEQVLQKFVQNKWLIEKEGEFTLHGRAILEMEQYIRETYPDAVKICNGoat anti Human IgG Fc (biotin)
Goat anti-human IgG Fc (biotin) was raised in goat using human igG, Fc fragment as the immunogen.Cathepsin G antibody
The Cathepsin G antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It offers exceptional photostability and cytotoxic properties, making it ideal for various research applications. This antibody targets the cycloalkyl group found in growth factors and polymerase enzymes, including EGF-like proteins.CD105 antibody
The CD105 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to CD105, also known as endoglin. CD105 is a cell surface glycoprotein that plays a crucial role in angiogenesis and vascular development. This antibody can be used in various immunoassays, including Western blotting, immunohistochemistry, and flow cytometry.CHD6 antibody
CHD6 antibody was raised in mouse using recombinant Human Chromodomain Helicase Dna Binding Protein 6 (Chd6)
RALYL antibody
RALYL antibody was raised using the C terminal of RALYL corresponding to a region with amino acids AQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDHuntingtin antibody
The Huntingtin antibody is a specific antibody that targets the huntingtin protein, which is associated with Huntington's disease. This monoclonal antibody is produced by a hybridoma cell line and has been extensively studied in various research fields, including Life Sciences. It has been shown to bind to the huntingtin protein and inhibit its function, making it a promising tool for studying the role of this protein in disease progression.SMP30 antibody
The SMP30 antibody is a highly specialized monoclonal antibody that is used in various assays within the Life Sciences field. This activated antibody is specifically designed to target transthyretin, an extracellular protein found in human serum. By immobilizing the SMP30 antibody on an electrode, it allows for the detection and quantification of transthyretin levels in samples. Additionally, this antibody has shown inhibitory effects on interferon activity, making it a valuable tool in immunological research and drug development. With its high specificity and sensitivity, the SMP30 antibody offers precise and reliable results for researchers in need of accurate protein analysis.NFATc1 antibody
NFATc1 antibody was raised in mouse using recombinant human NFATc1 (428-716aa) purified from E. coli as the immunogen.Spectrin antibody
The Spectrin antibody is a highly specialized monoclonal antibody that targets activated spectrin, a protein involved in various cellular processes. This antibody has been extensively studied for its potential therapeutic applications in adipose tissue growth regulation and hormone peptide signaling. It has also shown promise in the detection and neutralization of autoantibodies associated with certain autoimmune disorders. The Spectrin antibody works by binding to specific epitopes on spectrin, thereby inhibiting its interaction with other proteins such as calpain and annexin. This inhibition prevents abnormal cellular processes, including cytotoxicity and hemolysis, which are often observed in conditions like mycoplasma genitalium infection. With its high specificity and potency, the Spectrin antibody offers a valuable tool for researchers and clinicians studying spectrin-related diseases and developing targeted therapies.GAMT antibody
GAMT antibody was raised using the middle region of GAMT corresponding to a region with amino acids PGEGPFLTPWVGWTVLVHLEIKVLCLAQWLPGAVAQVYNPSTVEGRGGQIPKD2 antibody
The PKD2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It has been extensively tested and proven to have toxic effects on human serum, specifically targeting erythropoietin. This antibody is designed to bind to the PKD2 protein, inhibiting its activity and preventing its function in various cellular processes.Cat RBC antibody (Texas Red)
Feline RBC antibody (Texas Red) was raised in rabbit using feline erythrocytes as the immunogen.
ARL8B antibody
ARL8B antibody was raised using the middle region of ARL8B corresponding to a region with amino acids SRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDRETMED2 antibody
The TMED2 antibody is an essential tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to TMED2, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be highly effective in neutralizing the activity of TMED2.GR antibody
The GR antibody is a highly specialized antibody that targets and interacts with specific molecules involved in various biological processes. It is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific needs.FXN antibody
The FXN antibody is a highly specialized product in the field of Life Sciences. It plays a crucial role in endothelial growth and is widely used in various research applications. This antibody specifically targets calmodulin, a protein involved in signal transduction and cell proliferation.EGFR antibody
The EGFR antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to the epidermal growth factor receptor (EGFR). This receptor plays a crucial role in cell signaling and has been implicated in various diseases, including cancer.FAM83B antibody
FAM83B antibody was raised using the C terminal of FAM83B corresponding to a region with amino acids PRRKHSSSSNSQGSIHKSKEDVTVSPSQEINAPPDENKRTPSPGPVESKF
PARK7 antibody
The PARK7 antibody is a highly specialized monoclonal antibody that targets and inhibits the activity of phosphatase enzymes. This antibody has been extensively studied for its potential therapeutic applications in various fields, including insulin signaling, collagen synthesis, chemokine regulation, nuclear processes, and growth factor signaling.SMS antibody
The SMS antibody is a powerful tool in the field of Life Sciences. It is an anti-HER2 antibody that specifically targets and binds to HER2 receptors, which are overexpressed in certain types of cancer cells. This antibody can be used for various applications, such as immunofluorescence (IF) staining or Western blotting, to detect the presence of HER2 proteins in samples.TIMM17B antibody
The TIMM17B antibody is a highly specialized antibody that plays a crucial role in various biological processes. It acts as a calpastatin, inhibiting the activity of calpains and preventing their cytotoxic effects. This antibody can be used in research studies to investigate the role of calpain in cellular processes.Cytokeratin 7 antibody
The Cytokeratin 7 antibody is a diagnostic reagent that consists of polyclonal and monoclonal antibodies. These antibodies are specifically designed to target and neutralize cytokeratin 7, a metal-binding protein involved in various cellular processes. The Cytokeratin 7 antibody can be used in diagnostic tests to detect the presence of cytokeratin 7 in biological samples, such as tissue or blood. This antibody can also be used to study the role of cytokeratin 7 in iron homeostasis, as it has been shown to interact with spleen ferritin and regulate iron levels. Additionally, the Cytokeratin 7 antibody has been found to be activated by interferon, suggesting its potential as an antiviral agent.HSPA8 antibody
The HSPA8 antibody is a glycoprotein that plays a crucial role in various cellular processes. It acts as a chaperone protein, assisting in the folding and unfolding of other proteins. This antibody also interacts with mitogen-activated protein (MAP) kinases, specifically p38 MAPK, which is involved in cell signaling pathways. By modulating p38 MAPK activity, the HSPA8 antibody can influence cellular responses such as proliferation, differentiation, and apoptosis.
HSPBP1 antibody
The HSPBP1 antibody is a reactive antibody that targets the growth factor known as anti-glial fibrillary acidic protein (GFAP). It is commonly used in Life Sciences research and can be utilized for various applications. This monoclonal antibody specifically binds to GFAP, which is an intermediate filament protein found in astrocytes and other glial cells. The antibody can be used to detect and quantify GFAP levels in samples such as human serum or tissue sections. Additionally, it has been shown to have neuroprotective effects and can inhibit the activity of pancreatic elastase. The HSPBP1 antibody is a valuable tool for researchers studying glial cells and their involvement in various physiological processes.Cytokeratin 10 antibody
The Cytokeratin 10 antibody is a glycoprotein that is widely used in the field of Life Sciences. It is a monoclonal antibody specifically designed to target and bind to Cytokeratin 10, which is an important protein marker in various biological processes. This antibody has been extensively studied and shown to have high specificity and sensitivity in detecting Cytokeratin 10.NAT15 antibody
NAT15 antibody was raised using a synthetic peptide corresponding to a region with amino acids DYIQHLGSALASLSPCSIPHRVYRQAHSLLCSFLPWSGISSKSGIEYSRTTroponin I antibody (Cardiac)
Troponin I antibody (cardiac) was raised in mouse using amino acid residues 18-28 of cTnI as the immunogen.Lamin B1 antibody
The Lamin B1 antibody is a highly specialized product in the field of Life Sciences. This antibody is designed to specifically target and bind to Lamin B1, a protein involved in various cellular processes. The antibody is monoclonal, meaning it is derived from a single clone of cells and provides high specificity and sensitivity.
Dopamine beta Hydroxylase antibody
The Dopamine beta Hydroxylase antibody is a highly specialized antibody used in Life Sciences research. It is commonly used for studying endothelial growth and has neutralizing properties. This antibody is colloidal in nature, making it ideal for use in various immunoassays and antigen-antibody reactions.Ofloxacin antibody
The Ofloxacin antibody is a medicament that targets E-cadherin expression. It is a monoclonal antibody specifically designed for use in Life Sciences research. This antibody acts as an inhibitor of oncostatin, which plays a role in the regulation of E-cadherin expression. By binding to E-cadherin, the Ofloxacin antibody induces colloidal lysis and promotes cytotoxic effects on cells expressing this glycoprotein. It has been widely used in biochemical and cytotoxic studies, particularly in the field of helicobacter research.RNF207 antibody
RNF207 antibody was raised using the N terminal of RNF207 corresponding to a region with amino acids CLLDCFHDFCAGCLRGRATDGRLTCPLCQHQTVLKGPSGLPPVDRLLQFLGALE antibody
The GALE antibody is a monoclonal antibody that targets the glycoprotein GALE. This powerful antibody has been developed for various applications in the field of Life Sciences. It specifically recognizes and binds to the glycan structures on GALE, providing a valuable tool for researchers studying glycan-related processes.CNTN4 antibody
CNTN4 antibody is a highly specialized antibody that is used in the field of Life Sciences for various applications. It is a polyclonal antibody that specifically targets CNTN4, which is a protein involved in cell adhesion and signal transduction. This antibody can be used in research studies to investigate the role of CNTN4 in different biological processes, such as insulin signaling, annexin regulation, glucagon production, and alpha-fetoprotein expression. CNTN4 antibody has been extensively tested and validated for its specificity and sensitivity in detecting CNTN4 protein in human serum and tissue samples. It is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. The use of CNTN4 antibody can help elucidate the mechanisms underlying various physiological and pathological processes and contribute to advancements in biomedical research.KHSRP antibody
The KHSRP antibody is a highly specialized monoclonal antibody that is designed to target and bind to the KHSRP protein. This protein is found in nuclear extracts and plays a crucial role in various cellular processes. The KHSRP antibody has been extensively tested and validated for use in different assays, particularly in Life Sciences research.ALDH1L1 antibody
The ALDH1L1 antibody is a cytotoxic agent that targets superoxide and inhibits its activity. This antibody specifically binds to ALDH1L1, a protein kinase that plays a crucial role in cell growth and development. By blocking the activity of ALDH1L1, this antibody prevents the production of superoxide, which is known to cause oxidative damage to cells. Additionally, this antibody has been shown to have anti-VEGF (vascular endothelial growth factor) properties, making it an effective inhibitor of angiogenesis. With its high specificity and potency, the ALDH1L1 antibody is a valuable tool in life sciences research for studying cellular processes and developing new therapeutic strategies.PNMT antibody
The PNMT antibody is a monoclonal antibody that specifically targets and binds to the enzyme phenylethanolamine N-methyltransferase (PNMT). This enzyme plays a crucial role in the synthesis of epinephrine (adrenaline) from norepinephrine. By binding to PNMT, this antibody inhibits its catalytic activity, thereby reducing the conversion of norepinephrine to epinephrine.TMEM106B antibody
The TMEM106B antibody is a highly specialized antibody that has antiviral properties and plays a crucial role in proteolytic and polymerase activity. It is widely used in the field of Life Sciences for various applications, including research on liver microsomes and growth factors. This antibody is available in both monoclonal and polyclonal forms, allowing researchers to choose the most suitable option for their specific needs.
SAMSN1 antibody
SAMSN1 antibody was raised using the middle region of SAMSN1 corresponding to a region with amino acids YVDVISEEEAAPKKIKANRRSNSKKSKTLQEFLERIHLQEYTSTLLLNGYDDC antibody
DDC antibody was raised using a synthetic peptide corresponding to a region with amino acids SLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLPPM1M antibody
PPM1M antibody was raised using a synthetic peptide corresponding to a region with amino acids RRLKGDDLGQKVLFRDHHMSGWSYKRVEKSDLKYPLIHGQGRQARLLGTL
CMKLR1 antibody
The CMKLR1 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and neutralizes the alpha-fetoprotein, a protein associated with various diseases and conditions. This antibody can be used for a wide range of applications, including research, diagnostics, and therapeutics. It has been extensively tested and validated to ensure its high specificity and effectiveness.FBXL5 antibody
FBXL5 antibody was raised using the middle region of FBXL5 corresponding to a region with amino acids LRTMSSLPESSAMCRKAARTRLPRGKDLIYFGSEKSDQETGRVLLFLSLS
GAMT antibody
GAMT antibody was raised using the N terminal of GAMT corresponding to a region with amino acids MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMRPS15A antibody
RPS15A antibody was raised using the middle region of RPS15A corresponding to a region with amino acids KCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKHRBM39 antibody
RBM39 antibody was raised using the middle region of RBM39 corresponding to a region with amino acids FRGRYRSPYSGPKFNSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVRESYCP3 antibody
SYCP3 antibody was raised using the N terminal of SYCP3 corresponding to a region with amino acids VSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIE
