Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
TRIM56 antibody
TRIM56 antibody was raised in rabbit using the middle region of TRIM56 as the immunogenPurity:Min. 95%CUTC antibody
CUTC antibody was raised using a synthetic peptide corresponding to a region with amino acids KLYGADGLVFGALTEDGHIDKELCMSLMAICRPLPVTFHRAFDMVHDPMAMDPV Antibody
The MDPV Antibody is a highly specialized product used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to the growth factor MDPV (Mesenchymal Derived Paracrine Factor V). This antibody is produced using advanced techniques and has been extensively validated for its specificity and sensitivity.AMPK antibody
The AMPK antibody is a highly specialized human protein that plays a crucial role in various biological processes. It is widely used in Life Sciences research for its ability to detect and measure the levels of AMPK in different samples. The antibody works by specifically binding to AMPK, forming an antigen-antibody reaction that can be easily detected and quantified.
SHMT2 antibody
SHMT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEp73 antibody
The p73 antibody is a cytotoxic monoclonal antibody that belongs to the family of Polyclonal Antibodies. It acts as a growth factor by neutralizing certain proteins involved in cellular processes. This antibody has been shown to have specific binding affinity for adipose, collagen, fibrinogen, and other molecules related to Life Sciences. Additionally, it has been found to regulate the expression of β-catenin, phosphatase, interleukin-6, erythropoietin, and other factors involved in cell signaling pathways. The p73 antibody is a valuable tool for researchers studying various biological processes and can provide insights into disease mechanisms and potential therapeutic targets.IGF2BP1 antibody
IGF2BP1 antibody was raised using the middle region of IGF2BP1 corresponding to a region with amino acids YKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAICACNB2 antibody
CACNB2 antibody was raised using the C terminal of CACNB2 corresponding to a region with amino acids APHHNHRSGTSRGLSRQETFDSETQESRDSAYVEPKEDYSHDHVDHYASHCyclin J antibody
Cyclin J antibody was raised using the N terminal of CCNJ corresponding to a region with amino acids FMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNLcorticosterone monoclonal antibody
The corticosterone monoclonal antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets and binds to corticosterone, a hormone involved in various physiological processes. By neutralizing the effects of corticosterone, this monoclonal antibody can be used to study its role in different cellular pathways.Purity:>90% ±5% By Sds-PageLYN antibody
LYN antibody was raised using the N terminal of LYN corresponding to a region with amino acids DPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSF
Cytokeratin 20 antibody
Cytokeratin 20 antibody was raised in mouse using electrophoretically purified cytokeratin 20 from human intestinal mucosa as the immunogen.
Zika virus NS1 antibody
The Zika virus NS1 antibody is a potent treatment and/or prophylaxis option for individuals exposed to the Zika virus. This antibody specifically targets the NS1 protein found in the virus and effectively neutralizes its harmful effects. It has been extensively tested on human serum samples, demonstrating strong binding affinity with NS1 proteins.HPV16 E7 antibody
The HPV16 E7 antibody is a dinuclear antibody that specifically targets the human papillomavirus type 16 (HPV16) E7 protein. This antibody is widely used in Life Sciences research to study the expression and function of the HPV16 E7 protein. It can be used in various applications, including Western blotting, immunohistochemistry, and immunofluorescence. The HPV16 E7 antibody is produced using an expression plasmid containing the HPV16 E7 gene. It has been extensively validated and shows high specificity and sensitivity for detecting HPV16 E7 protein in human serum or tissue samples. When used in experiments, this monoclonal antibody effectively binds to the HPV16 E7 protein, leading to lysis of cells expressing this viral protein. It can also be used to detect the presence of HPV16 E7 in virus-infected cells or as a tool for studying the role of HPV16 E7 in cellular processes. Furthermore, this antibody has beenN6AMT1 antibody
N6AMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICLTransferrin antibody
The Transferrin antibody is a highly effective and neutralizing monoclonal antibody that is designed to target and inhibit the activity of transferrin. This antibody works by binding to transferrin molecules, preventing them from carrying out their normal functions. By doing so, it effectively neutralizes the activity of transferrin and disrupts processes such as lysis, which are dependent on its function.CHD1L antibody
CHD1L antibody was raised using the middle region of CHD1L corresponding to a region with amino acids DALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTLGAB1 antibody
The GAB1 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the growth factor GAB1. This antibody is widely used in various applications, including Western blotting, immunohistochemistry, and ELISA.
LTBP4 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Extensive research has shown its high efficacy through the use of advanced techniques such as transcription-quantitative polymerase chain reaction and patch-clamp technique. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Its specific binding to markers expressed in Mycobacterium tuberculosis strains further contributes to its effectiveness in inhibiting cell growth. Experience the power of 6-Fluoro-3-indoxyl-beta-D-galPurity:Min. 95%MCM6 antibody
MCM6 antibody was raised using the C terminal of MCM6 corresponding to a region with amino acids RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLENOX2 Antibody
The NOX2 Antibody is a neuroprotective and neutralizing agent that belongs to the field of Life Sciences. It is a glycosylated hormone peptide that targets specific receptors in the body. This antibody has been extensively researched and developed for its therapeutic potential in various applications.EPX antibody
EPX antibody was raised using the middle region of EPX corresponding to a region with amino acids LAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSAFFASWRIVYEGGIDPPurity:Min. 95%PABP Antibody
The PABP Antibody is a highly effective monoclonal antibody that targets the glycoprotein known as Poly(A)-binding protein (PABP). This antibody is specifically designed to immobilize and neutralize PABP, making it an ideal tool for various applications in the field of Life Sciences.SLC24A1 antibody
SLC24A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQLSRRPVAKVMALEDLSKPGDGAIAVDELQDNKKLKLPSLLTRGSSSTS
Purity:Min. 95%Vimentin antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection and is considered one of the most effective compounds for treating this condition. The drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, thus preventing transcription and replication. Extensive research has shown its high efficacy in human erythrocytes using a patch-clamp technique. Its active form undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their growth in culture.Vitamin D3 Antibody
Vitamin D3 Antibody is a monoclonal antibody that specifically targets and recognizes vitamin D3. This antibody is widely used in the field of life sciences for various applications, including research on sumoylation, insulin-like growth factor signaling, interferon response, and more. It can be utilized to detect and quantify vitamin D3 levels in biological samples or to study its interactions with other molecules such as alpha-synuclein. The Vitamin D3 Antibody is highly specific and exhibits strong affinity towards its target antigen, making it an essential tool for scientists working with recombinant proteins, tyrosine metabolism, fatty acid synthesis, and growth factors. With its immobilized form, this antibody provides convenience and reliability in experimental setups.
NDUFB5 antibody
NDUFB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEHWEYYKHPIS
Purity:Min. 95%FGF21 antibody
The FGF21 antibody is a monoclonal antibody that belongs to the category of antibodies used in Life Sciences. It targets and inhibits the activity of fibroblast growth factor 21 (FGF21), which is a growth factor involved in various biological processes. This antibody has been shown to have an impact on lipoprotein lipase activity, phosphatase activity, and the expression of apolipoprotein A-I (apoA-I). By targeting FGF21, this antibody can modulate lipid metabolism and potentially have therapeutic effects on conditions such as obesity and metabolic disorders. Additionally, it may interact with tyrosine kinase receptors and globulins to regulate signaling pathways related to growth hormone receptors. The FGF21 antibody represents a promising tool for research and development in the field of molecular biology and therapeutics.C15ORF15 antibody
C15ORF15 antibody was raised using the middle region of C15Orf15 corresponding to a region with amino acids FIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQEDAPP antibody
The APP antibody is a monoclonal antibody that targets amyloid precursor protein (APP). It is widely used in Life Sciences research to study the role of APP in various cellular processes. This antibody specifically detects the superoxide produced by APP metabolism, allowing researchers to investigate its involvement in oxidative stress-related diseases. Additionally, the APP antibody can be used to assess e-cadherin expression and monitor changes in cell adhesion. Its high specificity and sensitivity make it an essential tool for studying the function of APP and its potential as a therapeutic target. Researchers can also use this antibody to explore the impact of interferon-gamma on APP metabolism and investigate its interactions with other proteins such as tropomyosin. With its wide range of applications, the APP antibody is a valuable resource for scientists working in diverse fields such as neuroscience, immunology, and molecular biology.NuMA antibody
The NuMA antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the NuMA protein, which plays a crucial role in cell division and organization of the mitotic spindle. By binding to NuMA, this antibody can effectively neutralize its function and inhibit cell growth and division.MATK antibody
MATK antibody was raised in Mouse using a purified recombinant fragment of human MATK expressed in E. coli as the immunogen.SERPINA10 antibody
SERPINA10 antibody was raised in rabbit using the middle region of SERPINA10 as the immunogenPurity:Min. 95%PLA2G4E antibody
PLA2G4E antibody was raised using the C terminal of PLA2G4E corresponding to a region with amino acids TFFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEAT
AKT antibody
Akt, also known as Protein Kinase B (PKB), is a serine/threonine-specific kinase crucial for regulating key cellular functions, including growth, survival, metabolism, and proliferation. It operates within the PI3K/Akt/mTOR pathway, which integrates external signals to maintain cellular function and adaptation. Humans express three Akt isoforms—Akt1, Akt2, and Akt3—each encoded by a distinct gene. The activation of Akt generally starts when external signals like growth factors or insulin bind to cell surface receptors, activating phosphoinositide 3-kinase (PI3K). This leads to the production of phosphatidylinositol (3,4,5)-trisphosphate (PIP3) on the cell membrane, which attracts Akt to the membrane, where it undergoes phosphorylation at two specific sites, Thr308 and Ser473, to become fully active. Once activated, Akt moves through the cell to phosphorylate target proteins involved in various cellular pathways.The primary functions of Akt include promoting cell survival by inhibiting apoptosis through the inactivation of pro-apoptotic proteins like BAD and Caspase-9. It also supports cell growth and proliferation by activating mTOR, a central regulator of protein synthesis, while suppressing growth-arrest pathways. Akt plays a key role in metabolic regulation by increasing glucose uptake and glycolysis, largely through GLUT4 translocation and hexokinase activation, which is particularly important in muscle and fat tissues. It contributes to angiogenesis by upregulating VEGF expression, aiding tissue growth and repair, and it promotes cell migration, facilitating wound healing as well as the spread of cancer cells in malignancy. Due to its broad role in cell survival and growth, Akt is often hyperactivated in cancers, driving unchecked cell division and tumor growth, which makes the PI3K/Akt/mTOR pathway a target for many cancer therapies. Additionally, Akt's role in glucose metabolism links it to insulin signaling, where defects can impair glucose uptake, leading to insulin resistance and type 2 diabetes.CD1A antibody
The CD1A antibody is a histidine-rich, cytotoxic monoclonal antibody that targets the CD1A protein. This protein is involved in various cellular processes, including growth factor and chemokine signaling. The CD1A antibody has been extensively used in life sciences research, particularly in immunoassays and transfer reactions. It can be used for the detection and quantification of CD1A in various biological samples.HER2 antibody
The HER2 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes the epidermal growth factor receptor 2 (HER2). This receptor plays a crucial role in cell growth and division, and its overexpression has been linked to various types of cancer, including breast cancer.ANGPTL2 antibody
ANGPTL2 antibody was raised using the N terminal of ANGPTL2 corresponding to a region with amino acids NSKEPEVLLENRVHKQELELLNNELLKQKRQIETLQQLVEVDGGIVSEVKPurity:Min. 95%CD29 antibody
The CD29 antibody is a highly effective monoclonal antibody that has a wide range of applications in the field of Life Sciences. It is particularly useful for detecting autoantibodies and alpha-fetoprotein, as well as for studying the function of various proteins and glycopeptides. The CD29 antibody can also be used to investigate the role of arginase and leukemia inhibitory factor in different biological processes.BOP1 antibody
BOP1 antibody was raised using the N terminal of BOP1 corresponding to a region with amino acids PLLCTSPLSHSTGSDSGVSDSEESVFSGLEDSGSDSSEDDDEGDEEGEDGADARB2 antibody
ADARB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCGS100A3 antibody
The S100A3 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the S100A3 protein, which is associated with epidermal growth factor and cholinergic signaling pathways. This antibody has been extensively tested and validated for its specificity and sensitivity in various applications, including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA). The S100A3 antibody is known to bind to the S100A3 protein with high affinity, making it an essential tool for studying the role of this protein in cellular processes. Whether you are investigating the effects of androgens on choline acetyltransferase activity or examining the expression of S100A3 in human serum samples, this antibody will provide reliable results. Choose the S100A3 antibody for your research needs and unlock new insights into the intricate mechanisms of cellular function.GTPBP2 antibody
The GTPBP2 antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets GTPBP2, a protein involved in various cellular processes. This antibody can be used to detect the presence of GTPBP2 in samples and study its functions.DIRAS1 antibody
DIRAS1 antibody was raised using the middle region of DIRAS1 corresponding to a region with amino acids KCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKPurity:Min. 95%ASZ1 antibody
ASZ1 antibody was raised using the middle region of ASZ1 corresponding to a region with amino acids GKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDRPAPPA antibody
The PAPPA antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and binds to the protein known as Pregnancy-associated plasma protein A (PAPPA). PAPPA is an important biomarker that plays a crucial role in various biological processes, including epidermal growth factor regulation and cytotoxic activity.DLG7 antibody
DLG7 antibody was raised using the N terminal Of Dlg7 corresponding to a region with amino acids EYERNRHFGLKDVNIPTLEGRILVELDETSQELVPEKTNVKPRAMKTILGDR5 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, leading to the inhibition of bacterial growth. Through extensive research using a patch-clamp technique on human erythrocytes, it has been proven to have high efficacy in humans.LKB1 antibody
The LKB1 antibody is a monoclonal antibody that specifically targets the molecule known as mesothelin. It has been extensively tested in various studies and has shown high affinity for binding to human serum and collagen. This antibody is widely used in Life Sciences research for its ability to detect and analyze the expression of mesothelin in different samples.OGT antibody
The OGT antibody is a highly specialized antibody that targets the necrosis factor-related apoptosis-inducing protein complex. It is available in both monoclonal and polyclonal forms, making it suitable for a wide range of applications in Life Sciences research. This antibody is particularly useful for studying the regulation of alpha-fetoprotein, as well as the neutralizing effects on growth factors and nuclear steroid binding proteins. The OGT antibody is designed to specifically bind to its target in human serum, allowing for accurate and reliable results in various experiments. With its exceptional specificity and high affinity, this antibody is an essential tool for researchers working in the field of protein complex analysis.FGF5 antibody
FGF5 antibody was raised in mouse using highly pure recombinant human FGF-5 as the immunogen.
LANCL1 antibody
The LANCL1 antibody is a basic protein that plays a crucial role in various biological processes. It is commonly used in Life Sciences research to study the function and interactions of LANCL1. This antibody has shown promising results in studies involving collagen synthesis and its regulation. Additionally, it has been used in experiments investigating the effects of imatinib on LANCL1 activity. The LANCL1 antibody is known for its high specificity and sensitivity, making it an excellent tool for detecting LANCL1 levels in samples. Researchers have also utilized this antibody to detect autoantibodies, such as antiphospholipid antibodies, and explore their potential implications in disease development. Furthermore, this polyclonal antibody has been employed to examine the role of LANCL1 in steroid and glucagon signaling pathways. Overall, the LANCL1 antibody offers valuable insights into the functions and mechanisms associated with this protein, making it an essential tool for researchers in various fields of study.
RyR2 antibody
The RyR2 antibody is a polyclonal antibody that specifically targets the ryanodine receptor 2 (RyR2) protein. This antibody is widely used in life sciences research to study the role of RyR2 in various cellular processes. The RyR2 protein plays a crucial role in calcium release from the sarcoplasmic reticulum, which is essential for muscle contraction and relaxation. This antibody can be used for immunohistochemistry, western blotting, and other techniques to detect and quantify RyR2 expression levels in different tissues and cell types. It has been shown to have high specificity and sensitivity, making it a reliable tool for researchers studying calcium signaling, cardiac physiology, and other related fields. With its ability to bind to the target protein with high affinity, this antibody provides valuable insights into the regulation and function of RyR2 in both normal and pathological conditions.ARSA antibody
The ARSA antibody is a monoclonal antibody that plays a crucial role in the field of Life Sciences. It specifically targets and binds to arylsulfatase A (ARSA), an enzyme involved in the breakdown of sulfatides. By binding to ARSA, this antibody inhibits its activity, leading to a decrease in the breakdown of sulfatides.
EDD antibody
The EDD antibody is a monoclonal antibody that has neutralizing properties. It is specifically designed to target and bind to glycan molecules, thereby inhibiting the activity of TNF-α (tumor necrosis factor-alpha) and erythropoietin. This antibody is commonly used in ophthalmic formulations and in Life Sciences research for the detection and analysis of biomolecules. Additionally, the EDD antibody can be utilized in various assays to measure enzyme activity, such as phosphatase or lipoprotein lipase. Its high specificity and affinity make it an excellent tool for studying chemokines and other related proteins. For researchers looking for a reliable antibody with diverse applications, the EDD antibody is an ideal choice.Zdhhc11 antibody
Zdhhc11 antibody was raised in rabbit using the middle region of Zdhhc11 as the immunogenPurity:Min. 95%DPP3 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is known for its exceptional efficacy in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been demonstrated through patch-clamp technique studies on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their growth in culture.Leptin Receptor antibody
The Leptin Receptor antibody is a highly specialized monoclonal antibody that is designed to target and neutralize the leptin receptor in human serum. Leptin receptor plays a crucial role in regulating various physiological processes such as metabolism, appetite, and energy balance. This antibody specifically binds to the leptin receptor and inhibits its activity, thereby modulating the signaling pathways associated with it.
TIMP2 antibody
The TIMP2 antibody is a monoclonal antibody that plays a crucial role in neutralizing interferon. It is widely used in the field of Life Sciences and has shown promising results in various applications. This antibody specifically targets adipose tissue and has been found to have potential therapeutic effects in diseases related to adiponectin, such as obesity and diabetes.Transferrin antibody
The Transferrin antibody is a high-quality monoclonal antibody that has neutralizing properties. It is designed to target and bind to transferrin, a protein responsible for iron transport in the body. This antibody is made using advanced techniques and has been extensively tested for its efficacy and safety.PSMA4 antibody
PSMA4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNBub1 Antibody
The Bub1 Antibody is a highly effective monoclonal antibody that is widely used in Life Sciences research. It is specifically designed to target and neutralize the protein kinase activity of Bub1, a key regulator of the cell cycle. This antibody has been shown to inhibit the phosphorylation of downstream targets, such as p38 MAPK, and interfere with cell growth and proliferation. Additionally, it has been demonstrated to block the activation of phosphatases and reduce the levels of interleukin-6, an important pro-inflammatory cytokine. With its high specificity and potency, the Bub1 Antibody is an essential tool for studying cell signaling pathways and understanding their role in various biological processes.AGPAT4 antibody
The AGPAT4 antibody is a highly specialized polyclonal antibody that targets the AGPAT4 protein. This protein plays a crucial role in various cellular processes, including the regulation of glycosylation and lipid metabolism. The AGPAT4 antibody can be used for research purposes in the field of life sciences to study these processes and their implications in different diseases.PSMB5 antibody
PSMB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQFILIP1L antibody
FILIP1L antibody was raised using the middle region of FILIP1L corresponding to a region with amino acids KSLRPSLNGRRISDPQVFSKEVQTEAVDNEPPDYKSLIPLERAVINGQLYABCA1 antibody
The ABCA1 antibody is a neuroprotective monoclonal antibody that plays a crucial role in the field of Life Sciences. It is widely used in research and medical applications to study the function and regulation of ABCA1, a key protein involved in lipid metabolism and cholesterol efflux. This antibody specifically targets ABCA1 and inhibits its proteolytic activity, preventing the degradation of this important protein.SAMHD1 antibody
The SAMHD1 antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that has been developed for use in various research applications. The antibody can be used for particle chemiluminescence assays to detect the presence and activity of SAMHD1 protein. It has been shown to have high specificity and sensitivity, making it an ideal tool for studying this important protein.WDR13 antibody
WDR13 antibody was raised using the N terminal of WDR13 corresponding to a region with amino acids GQRYGPLSEPGSARAYSNSIVRSSRTTLDRMEDFEDDPRALGARGHRRSVNGAL antibody
NGAL antibody is a monoclonal antibody that specifically targets neutrophil gelatinase-associated lipocalin (NGAL). NGAL is a protein that plays a crucial role in various biological processes, including the regulation of epidermal growth factor and fatty acid metabolism. This antibody is widely used in Life Sciences research, particularly in the field of Antibodies and colloidal studies. It has been shown to inhibit the activity of growth factors such as anti-CD33 antibody and chemokines, as well as cytokines like interleukin-6. NGAL antibody is also used in the study of mesenchymal stem cells and their differentiation processes. Its high specificity and low viscosity make it an ideal tool for researchers studying NGAL-related pathways and developing inhibitors for therapeutic purposes.GGCX antibody
GGCX antibody was raised using the middle region of GGCX corresponding to a region with amino acids FLLRKLYVFRRSFLMTCISLRNLILGRPSLEQLAQEVTYANLRPFEAVGEPurity:Min. 95%Tau antibody
The Tau antibody is a highly specialized protein that plays a crucial role in the field of Life Sciences. It is widely used for ultrasensitive detection and analysis of protein carbonyls, particularly in human serum samples. This antibody has been extensively studied and proven to be effective in detecting and neutralizing fibrinogen, a key protein involved in blood clotting.NRCAM antibody
NRCAM antibody was raised using the N terminal of NRCAM corresponding to a region with amino acids PLILFLCQMISALEVPLDLVQPPTITQQSPKDYIIDPRENIVIQCEAKGKPurity:Min. 95%HDAC2 antibody
The HDAC2 antibody is a monoclonal antibody used in Life Sciences research. It is designed to target and bind to histone deacetylase 2 (HDAC2), an enzyme involved in the regulation of gene expression. This antibody can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry.
GBL antibody
GBL antibody was raised using a synthetic peptide corresponding to a region with amino acids CAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVLST14 antibody
ST14 antibody is a monoclonal antibody that targets protein kinase ST14. It is widely used in Life Sciences research for its ability to specifically bind to ST14 and inhibit its activity. This antibody has been shown to effectively block the function of ST14, preventing its interaction with other proteins and interfering with various cellular processes. Additionally, ST14 antibody has been used in studies involving albumin, inhibitors, antibodies, tyrosine, alpha-synuclein, activated mitogen-activated protein (MAP) kinases, collagen, and glucose transporter. It is also known to enhance the cytotoxic effects of certain anti-CD20 antibodies. With its high specificity and potency, ST14 antibody is a valuable tool for scientists studying protein kinase signaling pathways and their role in disease development and progression.
HORMAD2 antibody
HORMAD2 antibody was raised using the middle region of HORMAD2 corresponding to a region with amino acids YTDPMGSEKVTEMYQFKFKYTKEGATMDFDSHSSSTSFESGTNNEDIKKAALDH2 antibody
The ALDH2 antibody is an activated basic protein that falls under the category of Life Sciences. It is a monoclonal antibody that targets ALDH2, an enzyme involved in the metabolism of alcohol and other aldehydes. This antibody has been widely used in research studies to investigate the role of ALDH2 in various biological processes.
PGAM1 antibody
The PGAM1 antibody is a highly specific monoclonal antibody that targets the growth factor PGAM1. This antibody has been extensively studied in the field of life sciences and has shown promising results in various applications. It specifically binds to the influenza hemagglutinin protein, preventing its interaction with host cells and inhibiting viral replication.cSRC antibody
The cSRC antibody is a highly specialized monoclonal antibody that specifically targets the cSRC protein. This protein plays a crucial role in various cellular processes, including cell growth and proliferation. The cSRC antibody has been extensively studied and proven to be an effective inhibitor of the activated cSRC protein.S100A6 antibody
The S100A6 antibody is a protein that is widely used in life sciences research. It is a polyclonal antibody that specifically targets the S100A6 protein. This antibody has been shown to have low density binding to MCF-7 cells, making it ideal for use in various applications such as immunofluorescence, immunoprecipitation, and Western blotting. The S100A6 antibody has also been shown to interact with other proteins such as annexin A2 and fatty acid-binding protein, suggesting its involvement in diverse cellular processes. Additionally, this antibody has monoclonal counterparts available for specific applications. With its high specificity and sensitivity, the S100A6 antibody is an essential tool for studying the role of this protein in growth factor signaling pathways and cellular processes.
CD62L antibody (Azide Free)
CD62L antibody (Azide Free) was raised in Rat using C3H/eb cloned mouse B lymphoma 38C-13 as the immunogen.SPTLC2 antibody
SPTLC2 antibody was raised using the N terminal of SPTLC2 corresponding to a region with amino acids VLTYVGYGVLTLFGYLRDFLRYWRIEKCHHATEREEQKDFVSLYQDFENF
IFN γ antibody
IFN gamma antibody was raised in Mouse using recombinant human IFN-gamma (BioSource company, Cat.No. PHC4033) as the immunogen.Tcea3 antibody
Tcea3 antibody was raised in rabbit using the C terminal of Tcea3 as the immunogen
Purity:Min. 95%CD86 antibody (Azide Free)
CD86 antibody (Azide free) was raised in rat using LPS-activated murine B cells as the immunogen.DUSP3 antibody
The DUSP3 antibody is a highly specific monoclonal antibody that targets the dual specificity phosphatase 3 (DUSP3) protein. This antibody plays a crucial role in various biological processes, including cell growth, differentiation, and immune response regulation.ASB11 antibody
ASB11 antibody was raised using the C terminal of ASB11 corresponding to a region with amino acids GQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSVKCNJ16 antibody
KCNJ16 antibody was raised using the middle region of KCNJ16 corresponding to a region with amino acids RESCTSDTKARRRSFSAVAIVSSCENPEETTTSATHEYRETPYQKALLTL
Purity:Min. 95%Human IgM Antibody
The Human IgM Antibody is a monoclonal antibody that plays a crucial role in the human immune system. It specifically targets and binds to antigens, helping to neutralize and eliminate harmful pathogens. This antibody is widely used in various fields of research, including life sciences and medical diagnostics.
PRD antibody
PRD antibody was raised using the middle region of PRD corresponding to a region with amino acids MTVTAFAAAMHRPFFNGYSTMQDMNSGQGRVNQLGGVFINGRPLPNNIRLCDK2 antibody
The CDK2 antibody is an essential tool in the field of Life Sciences. It is an antigen that has antiviral properties and can be used to neutralize harmful viruses. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs.
CD71 antibody
The CD71 antibody is a powerful tool in the field of Life Sciences. This steroid-based antibody specifically targets the CD71 molecule, also known as transferrin receptor 1. It plays a crucial role in iron metabolism and is highly expressed on the surface of proliferating cells.
GTPBP2 antibody
GTPBP2 antibody was raised using the N terminal of GTPBP2 corresponding to a region with amino acids GCGGPKGKKKNGRNRGGKANNPPYLPPEAEDGNIEYKLKLVNPSQYRFEHCD15 antibody
CD15 antibody is a monoclonal antibody that targets the CD15 antigen, also known as Lewis X. It has been shown to have anti-tumor activity by inhibiting endothelial growth and inducing apoptosis in cancer cells. CD15 antibody can also be used in combination with other antibodies, such as anti-CD33 antibody or tyrosine kinase inhibitors, to enhance its cytotoxic effects. Additionally, CD15 antibody has shown neutralizing activity against vascular endothelial growth factor (VEGF) and tumor necrosis factor-alpha (TNF-α), which are important factors in promoting tumor growth and inflammation. This antibody has demonstrated efficacy in various cancer models, including MCF-7 breast cancer cells and circumsporozoite protein-expressing tumors. Its potential therapeutic applications make CD15 antibody a promising candidate for targeted cancer therapy.
