Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75562 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
RPS6 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. Specifically designed to combat tuberculosis infection, this active compound exhibits bactericidal activity by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase. This prevents transcription and replication, effectively halting the spread of the disease. Additionally, it has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Metabolized through various pathways including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, this drug delivers targeted treatment against Mycobacterium tuberculosis strains. With its multifaceted mechanism of action and proven efficacy, 6-Fluoro-3-indoxyl-beta-D-galactopyranosUSP48 antibody
USP48 antibody was raised using the middle region of USP48 corresponding to a region with amino acids ALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYVKeratin K13 antibody
Keratin K13 antibody was raised in mouse using Keratin K13 purified from human esophagus as the immunogen.MAGE antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug that falls under the class of rifamycins. This active compound is highly effective in treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. Its bactericidal activity has been confirmed through extensive research using techniques like patch-clamp and transcription-quantitative polymerase chain. Metabolically, this drug undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth. Experience the powerful action of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for effective treatment against tuberculosis.ATPase antibody
The ATPase antibody is a highly specialized monoclonal antibody that targets ATPases, which are enzymes responsible for hydrolyzing ATP into ADP and phosphate. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.TBCA antibody
TBCA antibody was raised in mouse using recombinant TBCA (1-108aa) purified from E. coli as the immunogen.
CGRRF1 antibody
CGRRF1 antibody was raised using the middle region of CGRRF1 corresponding to a region with amino acids KKDSKEEIYCQLPRDTKIEDFGTVPRSRYPLVALLTLADEDDREIYDIISMGP antibody
MGP antibody was raised using the middle region of MGP corresponding to a region with amino acids INRRNANTFISPQQRWRAKVQERIRERSKPVHELNREACDDYRLCERYAM
Purity:Min. 95%IFIH1 antibody
IFIH1 antibody was raised using the middle region of IFIH1 corresponding to a region with amino acids QINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDEDISG15 antibody
ISG15 antibody was raised in mouse using recombinant human ISG15 (1-157aa) purified from E. coli as the immunogen.
FAM84B antibody
The FAM84B antibody is a diagnostic reagent used in the Life Sciences field. It specifically targets the FAM84B protein, which is involved in various biological processes such as lipoprotein lipase activity and growth factor signaling. This monoclonal antibody has high affinity and specificity for FAM84B, making it an excellent tool for research and diagnostic purposes. The FAM84B antibody can be used in assays to detect the presence of FAM84B in human serum or other samples. Its binding capability to serum albumin ensures stability and reliable results. Additionally, this antibody has been extensively tested for toxic effects and meets all safety standards. With its exceptional performance and reliability, the FAM84B antibody is an essential biomolecule for any researcher or laboratory working in the field of Life Sciences.Ku70 antibody
The Ku70 antibody is a highly effective anti-HER2 antibody that targets the growth factor protein VEGF-C. This monoclonal antibody exhibits multidrug resistance and has been extensively studied for its therapeutic potential. The Ku70 antibody specifically binds to HER2 receptors, inhibiting their activation and signaling pathways. Additionally, this antibody has shown promising results in blocking the interaction between HER2 and β-catenin, a key player in cancer progression. Furthermore, the Ku70 antibody has been found to disrupt cell adhesion by targeting fibronectin and collagen, leading to impaired tumor growth and metastasis. Its ability to inhibit epidermal growth factor and endothelial growth factors further contributes to its anti-cancer properties. With its exceptional specificity and potency, the Ku70 antibody holds great promise as a targeted therapy for HER2-positive cancers.Scfd2 antibody
Scfd2 antibody was raised in rabbit using the middle region of Scfd2 as the immunogenPurity:Min. 95%KIAA1958 antibody
KIAA1958 antibody was raised using the C terminal of KIAA1958 corresponding to a region with amino acids SPITLLSTVVKYNSQYLNMRTLQEHADLMYGDIELLKDPQNQPYFARTDSACY1 antibody
The ACY1 antibody is a monoclonal antibody that targets the ACY1 protein. This protein is involved in various biological processes, including the metabolism of drugs and toxins. The ACY1 antibody can be used in Life Sciences research to study the role of ACY1 in different cellular pathways.XPB antibody
The XPB antibody is a polyclonal antibody that has an inhibitory effect on the growth factor XPB. It exhibits antioxidant activity and can be used in various applications, such as immobilization in Life Sciences research or industrial settings. The XPB antibody is commonly used in studies involving polymerase chain reactions (PCR) and molecular docking experiments. It can also be utilized as a tool for protein kinase assays. Additionally, monoclonal antibodies and DNA aptamers targeting XPB are available for specific applications. With its versatile nature and high-quality performance, the XPB antibody is an essential component in many scientific endeavors.
4EBP1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug belonging to the rifamycins class. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. Metabolized through various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.Purity:Min. 95%TMEFF2 antibody
The TMEFF2 antibody is a highly reactive monoclonal antibody that is used in the field of Life Sciences. It specifically targets TMEFF2, a protein involved in various cellular processes. This antibody can be used for applications such as immunohistochemistry, western blotting, and flow cytometry. The TMEFF2 antibody binds to TMEFF2 with high affinity, allowing for accurate detection and analysis of this protein. Its specificity ensures minimal cross-reactivity with other proteins, making it an ideal choice for research and diagnostic purposes. With its exceptional performance and reliability, the TMEFF2 antibody is a valuable tool for scientists and researchers in the Life Sciences field.Toll-like receptor 2 antibody
The Toll-like receptor 2 antibody is a highly specialized monoclonal antibody that has the ability to neutralize the activity of Toll-like receptor 2 (TLR2). TLR2 is a key player in the immune response, as it recognizes and responds to various pathogens and danger signals. This antibody has been pegylated to enhance its stability and prolong its half-life in the body.CCR5 antibody
CCR5 antibody is a type of monoclonal antibody that targets the C-C chemokine receptor, which plays a crucial role in immune response and inflammation. This antibody has minimal toxicity and has been extensively studied for its therapeutic potential in various diseases. It binds to the CCR5 receptor, preventing the interaction with its ligands such as macrophage inflammatory protein-1alpha (MIP-1α), thereby neutralizing their effects.BAIAP2L2 antibody
The BAIAP2L2 antibody is a polyclonal antibody that targets the colony-stimulating factor. It is widely used in life sciences research to study various biological processes. This antibody specifically binds to BAIAP2L2, which plays a crucial role in cell growth and development. By targeting this protein, the BAIAP2L2 antibody can help researchers gain insights into the mechanisms involved in cellular processes such as actin filament formation, growth factor signaling, and steroid and glucagon production. Additionally, this antibody has been shown to inhibit the activity of TGF-β1, a potent growth factor involved in cell proliferation and differentiation. With its high specificity and effectiveness, the BAIAP2L2 antibody is an invaluable tool for scientists studying cellular pathways and developing potential therapeutic inhibitors.Purity:Min. 95%ARF1 antibody
ARF1 antibody was raised in mouse using recombinant human ARF1 (1-181aa) purified from E. coliBECN1 antibody
The BECN1 antibody is a highly potent cytotoxic agent that targets epidermal growth factor (EGF) receptors. It is an anti-CD33 antibody that specifically binds to CD33, a transmembrane protein expressed on myeloid cells. This monoclonal antibody can be used in various life science applications, including research and diagnostics. The BECN1 antibody can be conjugated with cytotoxic agents to create cytotoxic conjugates for targeted cancer therapy. It has been extensively studied and proven to be effective in inhibiting the growth of cancer cells in preclinical models. Additionally, this antibody exhibits excellent binding specificity and minimal cross-reactivity with other proteins present in human serum. The glycosylation of the BECN1 antibody ensures stability and enhances its therapeutic potential. Overall, the BECN1 antibody is a valuable tool for researchers and clinicians working in the field of oncology and immunotherapy.CBL antibody
CBL antibody is a monoclonal antibody that targets the colony-stimulating factor CBL. It has been shown to neutralize the activity of CBL and inhibit its function in promoting cell growth and survival. This antibody can also bind to antiphospholipid antibodies and interfere with their ability to activate immune responses. Additionally, it has been demonstrated to block the interaction between E-cadherin and interferon, leading to decreased cell adhesion and migration. The CBL antibody is available in both monoclonal and polyclonal forms, providing flexibility for different experimental needs. It can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry. With its high specificity and potency, this antibody offers researchers a valuable tool for studying the role of CBL in cellular processes and disease development.Calbindin antibody (D28K)
Calbindin antibody (D28K) was raised in mouse using calbindin D-28k as the immunogen.IFNG antibody
IFNG antibody is a monoclonal antibody that specifically targets interferon-gamma (IFN-γ), a cytokine involved in immune responses. This antibody has the ability to neutralize the effects of IFN-γ by binding to it and preventing its interaction with target cells. It has been shown to have neuroprotective properties, protecting neurons from damage caused by various factors such as oxidative stress or inflammation. Additionally, IFNG antibody can be used in research and diagnostics in the life sciences field, particularly in studies involving collagen, human serum, or multidrug binding proteins. This antibody can also be immobilized on electrodes for use in immunoassays or other analytical techniques. Whether you need a high-quality product description for an eCommerce platform or engaging content for your website, I can help you create compelling copy that showcases the unique characteristics and benefits of your products. Let's work together to elevate your brand and drive sales!CD1D antibody
The CD1D antibody is a polyclonal antibody used in life sciences research. It targets CD1D, a protein involved in various cellular processes such as hepatocyte growth, chemokine production, and telomerase activity. This antibody has been shown to have cytotoxic effects on specific cell types and may be useful for studying thrombocytopenia and nephrotoxicity. Additionally, the CD1D antibody can be used to detect CXCR4 expression and inhibit its function. It belongs to the family of kinase inhibitors and is available as both colloidal and monoclonal antibodies. Researchers can rely on the high quality and specificity of this antibody for their experiments in various fields of study.AKAP5 antibody
AKAP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIEFeline Leukemia Virus p27 antibody (biotin)
Goat polyclonal Feline Leukemia Virus p27 antibody (biotin)UPB1 antibody
UPB1 antibody was raised using the middle region of UPB1 corresponding to a region with amino acids NRVGTEHFPNEFTSGDGKKAHQDFGYFYGSSYVAAPDSSRTPGLSRSRDG
p70 S6 Kinase antibody
The p70 S6 Kinase antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. This neutralizing antibody is specifically designed to target and inhibit the activity of p70 S6 Kinase, an important biomolecule involved in various cellular processes. By blocking the function of p70 S6 Kinase, this antibody can effectively modulate cell signaling pathways and regulate protein synthesis.Annexin A7 antibody
Annexin A7 antibody was raised using the N terminal of ANXA7 corresponding to a region with amino acids GGQMPSQYPGGQPTYPSQPATVTQVTQGTIRPAANFDAIRDAEILRKAMKGST Antibody
The GST Antibody is a highly specific and potent antibody that targets the cytosolic protein GST. It is designed to recognize and bind to the target molecule with high affinity, making it an ideal tool for various applications in Life Sciences research. The antibody is produced using advanced techniques, including DNA aptamer technology, resulting in a highly purified and effective product.KCNAB3 antibody
KCNAB3 antibody was raised using the N terminal of KCNAB3 corresponding to a region with amino acids RNLGKSGLRVSCLGLGTWVTFGSQISDETAEDVLTVAYEHGVNLFDTAEVNR2C2 antibody
NR2C2 antibody was raised using the C terminal of NR2C2 corresponding to a region with amino acids AQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNSZNF557 antibody
ZNF557 antibody was raised in rabbit using the middle region of ZNF557 as the immunogenPurity:Min. 95%Chromogranin A antibody
Chromogranin A antibody was raised using a synthetic peptide corresponding to a region with amino acids DSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQPurity:Min. 95%FGFR1 antibody
FGFR1 antibody was raised in Mouse using purified recombinant extracellular fragment of human FGFR1(aa33-423) fused with hIgGFc tag expressed in HEK293 cells as the immunogen.PLOD3 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an exceptional antituberculosis drug that falls under the class of rifamycins. With its bactericidal activity and potent ability to inhibit bacterial growth, it is considered one of the most effective treatments for tuberculosis infections. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication. The high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, this drug specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.DLG4 antibody
DLG4 antibody was raised using a synthetic peptide corresponding to a region with amino acids AAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSRanBP1 antibody
RanBP1 antibody was raised using the C terminal of RANBP1 corresponding to a region with amino acids KFEECRKEIEEREKKAGSGKNDHAEKVAEKLEALSVKEETKEDAEEKQCDK2 antibody
The CDK2 antibody is a monoclonal antibody that belongs to the family of kinase inhibitors. It is used in Life Sciences research to study the growth factor signaling pathways and their role in various cellular processes. The CDK2 antibody specifically targets and neutralizes the activity of cyclin-dependent kinase 2 (CDK2), an enzyme involved in cell cycle regulation. By inhibiting CDK2, this antibody can block the proliferation of cancer cells and other cell types.Crystallin Zeta antibody
Crystallin Zeta antibody was raised using a synthetic peptide corresponding to a region with amino acids KGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEINPRDTMAKESSPIK3CA antibody
The PIK3CA antibody is a polyclonal antibody that targets the PIK3CA gene, which encodes the p110α subunit of phosphatidylinositol 3-kinase (PI3K). This antibody is commonly used in life sciences research to study the role of PIK3CA in various cellular processes. It has been shown to inhibit protease activity and mitogen-activated protein kinase (MAPK) signaling pathway, both of which are involved in cell proliferation and survival. The PIK3CA antibody exhibits high substrate specificity for its target and has strong DNA binding activity. It is commonly used in flow immunoassays to detect activated PIK3CA in primary cells. Additionally, this antibody has neutralizing properties against interleukin-6 (IL-6), an inflammatory cytokine involved in various diseases. Whether you're studying signal transduction pathways or investigating therapeutic targets, the PIK3CA antibody is an essential tool for your research needs
LRRC50 antibody
LRRC50 antibody was raised using the N terminal of LRRC50 corresponding to a region with amino acids LNDTLYLHFKGFDRIENLEEYTGLRCLWLQSNGIQKIENLEAQTELRCLFSIX1 antibody
The SIX1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the protein SIX1, which plays a crucial role in various biological processes, including development, cell growth, and differentiation. This antibody can be used to detect and quantify the levels of SIX1 in human serum samples or tissue sections.TMOD1 antibody
The TMOD1 antibody is a compound that inhibits serotonin, adeno-associated virus, and heparin. It is commonly used in Life Sciences research and has been shown to inhibit the activity of heparin cofactor. This polyclonal antibody targets specific polypeptides and can be used in the development of new medicines. With its inhibiting properties, the TMOD1 antibody is a valuable tool for researchers studying various biological processes.ASPH antibody
ASPH antibody was raised using the N terminal of ASPH corresponding to a region with amino acids SEVLQGKLGIYDADGDGDFDVDDAKVLLEGPSGVAKRKTKAKVKELTKEELYK5 antibody
LYK5 antibody was raised using the C terminal of LYK5 corresponding to a region with amino acids AEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFV
Nucleolin antibody
Nucleolin antibody was raised using the N terminal of NCL corresponding to a region with amino acids GKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDED
DLX5 antibody
The DLX5 antibody is a highly specialized and potent tool in the field of life sciences. It is a polyclonal antibody that specifically targets DLX5, a transcription factor involved in various cellular processes. This antibody can be used for research purposes, such as studying the role of DLX5 in development and disease progression.GREM2 antibody
GREM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIKSRP68 antibody
SRP68 antibody was raised using the N terminal of SRP68 corresponding to a region with amino acids EENKENERPSAGSKANKEFGDSLSLEILQIIKESQQQHGLRHGDFQRYRGChlamydia trachomatis antibody (biotin)
Chlamydia trachomatis antibody (biotin) was raised in rabbit using L2 and other serovar groups as the immunogen.IFITM3 antibody
The IFITM3 antibody is a polyclonal antibody that acts as an immunomodulatory agent. It specifically targets the glycoprotein IFITM3, which plays a crucial role in various biological processes. This antibody is widely used in the field of Life Sciences to study the function and regulation of IFITM3.Enolase 3 antibody
Enolase 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRPDXP antibody
PDXP antibody was raised using a synthetic peptide corresponding to a region with amino acids DPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSI
HIST1H1C antibody
HIST1H1C antibody was raised using the middle region of HIST1H1C corresponding to a region with amino acids ASGSFKLNKKAASGEAKPKVKKAGGTKPKKPVGAAKKPKKAAGGATPKKS
ATF4 antibody
The ATF4 antibody is a polyclonal antibody that belongs to the group of antibodies used in Life Sciences research. It specifically targets ATF4, a transcription factor involved in cellular stress response and regulation of gene expression. This antibody can be used for various applications, such as Western blotting, immunohistochemistry, and immunofluorescence.
BAG4 antibody
The BAG4 antibody is a highly specialized antibody used in the field of Life Sciences. It is a polyclonal antibody that has been extensively studied and proven to be effective in various research applications. This antibody specifically targets BAG family molecular chaperone regulator 4 (BAG4), which plays a crucial role in cell signaling and regulation.
PIK3R3 antibody
PIK3R3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNESERPINB4 antibody
SERPINB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids TSALGMVLLGAKDNTAQQISKVLHFDQVTENTTEKAATYHVDRSGNVHHQPSMA1 antibody
PSMA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLTF antibody
TF antibody is a polyclonal antibody that specifically targets transferrin (TF), a protein involved in the transport of iron in the body. This antibody has high specificity and activity, making it ideal for various applications in life sciences research. TF antibody can be used to study the role of transferrin in different biological processes, such as iron metabolism, immune response, and cell signaling pathways. Additionally, this antibody has been shown to have neutralizing properties against certain interferons, further expanding its potential applications. With its high specific activity and ability to bind to annexin A2, TF antibody offers researchers a valuable tool for investigating the function and regulation of transferrin in diverse cellular contexts.ZNF19 antibody
ZNF19 antibody was raised using the C terminal of ZNF19 corresponding to a region with amino acids HQHQRIHTGEKPYECSKYEKAFGTSSQLGHLEHVYSGEKPVLDICRFGLPCLCN6 antibody
CLCN6 antibody was raised using the C terminal of CLCN6 corresponding to a region with amino acids PQFQSISLRKIQFNFPYFRSDRDKRDFVSAGAAAGVAAAFGAPIGGTLFSIFN γ antibody
The IFN gamma antibody is a monoclonal antibody that specifically targets and neutralizes interferon-gamma (IFN-gamma). It is commonly used in life sciences research and diagnostic assays to detect and measure the presence of IFN-gamma. This antibody binds to the antigen with high affinity, effectively blocking its activity. The IFN gamma antibody is produced using advanced biotechnology techniques and is highly purified for optimal performance. It does not contain any excipients or additives that may interfere with experimental results. This monoclonal antibody offers exceptional specificity and sensitivity, making it an essential tool for studying immune responses and cytokine signaling pathways.ARRB1 antibody
The ARRB1 antibody is a potent compound that belongs to the class of Polyclonal Antibodies. It acts as a molecular marker and has inhibitory activity against heparin cofactor and serotonin. This antibody can be used as a serum marker for various medical conditions. Additionally, it has been shown to inhibit the activity of autoantibodies and other inhibitors. The ARRB1 antibody specifically targets an antigen expressed by adeno-associated viruses and polypeptides. With its strong inhibitory properties, this antibody is a valuable tool in research and therapeutic applications.MAGEA1 antibody
MAGEA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVLGTLEEVPTAGSTDPPQSPQGASAFPTTINFTRQRQPSEGSSSREEEGACLY antibody
ACLY antibody was raised using the middle region of ACLY corresponding to a region with amino acids SRTASFSESRADEVAPAKKAKPAMPQDSVPSPRSLQGKSTTLFSRHTKAI
RIOK2 antibody
RIOK2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDYNRHAVVMELINGYPLCQIHHVEDPASVYDEAMELIVKLANHGLIHGD
BRMS1 antibody
The BRMS1 antibody is a highly reactive monoclonal antibody that has neutralizing properties. It is widely used in the field of Life Sciences for various applications. This antibody specifically binds to BRMS1, a protein involved in iron homeostasis and lipid binding. It has been shown to inhibit the activity of BRMS1, leading to changes in cellular processes such as sphingosine metabolism and inositol signaling pathways. The BRMS1 antibody has also been used as a medicament for the treatment of influenza, as it can block the interaction between influenza hemagglutinin and transferrin receptors on host cells. This antibody is available as both monoclonal and polyclonal antibodies and can be used for various research purposes, including immunoblotting, immunoprecipitation, and nuclear extract analysis.RIC8B antibody
RIC8B antibody was raised using a synthetic peptide corresponding to a region with amino acids KETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLTPVLSLLTEp90RSK antibody
The p90RSK antibody is a highly specialized antibody that targets the p90 ribosomal S6 kinase (p90RSK). This antibody can be used for various applications in life sciences, including research on calmodulin, interleukin-6, adipose tissue, and amyloid proteins. It is available as both polyclonal and monoclonal antibodies.TPM4 antibody
The TPM4 antibody is a highly specialized monoclonal antibody that targets the antimicrobial peptide TPM4. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It has been found to neutralize parathyroid hormone-related peptide (PTHrP), a protein associated with bone metabolism and cancer progression. Additionally, the TPM4 antibody has been shown to inhibit mitogen-activated protein (MAP) kinase signaling, which plays a crucial role in cell proliferation and differentiation. This antibody can be used in antibody preparations for research purposes, such as detecting TPM4 expression levels through techniques like transcription-polymerase chain reaction (PCR). Furthermore, the TPM4 antibody has demonstrated its ability to induce apoptosis and inhibit the growth of cancer cells by targeting growth factors and cytokines like colony-stimulating factor and interleukin-6. Whether you're conducting cutting-edge research or developing innovative therapeutic strategies, the TPM4 antibody is an invaluable tool in your arsenal.Fank1 antibody
Fank1 antibody was raised in rabbit using the middle region of Fank1 as the immunogen
Purity:Min. 95%14-3-3 epsilon antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been demonstrated through extensive research using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique.53BP1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections as it contains active compounds with bactericidal activity. Through its mechanism of action, this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has confirmed its efficacy through various techniques like transcription-quantitative polymerase chain and patch-clamp technique. The drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth. With its impressive properties and proven effectiveness, the 6-Fluoro-3-indoxyl-beta-DRFPL2 antibody
RFPL2 antibody was raised using the C terminal of RFPL2 corresponding to a region with amino acids VSFFDAESGSHVYTFRSVSAEEPLRPFLAPSVPPNGDQGVLSICPLMNSGSREBF1 antibody
SREBF1 antibody was raised in rabbit using the middle region of SREBF1 as the immunogen
NPM antibody
Nucleolar Protein NO38 antibody was raised in mouse using Nucleolar fraction prepared from Xenopus laevis oocytes as the immunogen.
