Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75562 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
CLIC5 antibody
CLIC5 antibody was raised using the middle region of CLIC5 corresponding to a region with amino acids HPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSS100A9 antibody
The S100A9 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize the activity of S100A9 protein, which is known to be involved in various cellular processes. This antibody has been extensively studied and proven to be effective in inhibiting the growth factor activity of S100A9. It can be used as a valuable tool in research studies focusing on androgen inhibitors, as well as in the development of therapeutics targeting this specific protein. The S100A9 antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific experimental needs. With its high specificity and reliability, this antibody is an essential component in any study involving S100A9 protein.BLVRB antibody
BLVRB antibody was raised using the middle region of BLVRB corresponding to a region with amino acids GLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDBIRC5 antibody
The BIRC5 antibody is a potent family kinase inhibitor that belongs to the class of inhibitors used in Life Sciences. It targets the growth factor receptors and tyrosine kinases, inhibiting their activity and preventing cell proliferation. The BIRC5 antibody has been shown to have significant effects on breast cancer cells such as MCF-7, reducing their viability and inducing apoptosis. This monoclonal antibody has also been found to interact with other proteins such as annexin and fibrinogen, suggesting its potential role in various biological processes. Additionally, the BIRC5 antibody has been used as a research tool in neuroscience studies, specifically in investigating the role of dopamine receptors. With its high specificity and affinity, this antibody is an invaluable tool for researchers in understanding cellular signaling pathways and developing targeted therapies.FABP3 antibody
FABP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGDHFR antibody
The DHFR antibody is a monoclonal antibody that has inhibitory properties against dihydrofolate reductase (DHFR), an enzyme involved in the synthesis of DNA, RNA, and proteins. This antibody specifically binds to DHFR and prevents its activity, leading to cytotoxic effects on cells. It is commonly used in Life Sciences research for various applications, including Western blotting, immunohistochemistry, and flow cytometry. The DHFR antibody has been shown to inhibit the growth of cancer cells by targeting the β-catenin pathway and blocking the activation of epidermal growth factor receptors. Additionally, this antibody has been found to have creatine kinase inhibitory properties, which may be beneficial in certain disease conditions. With its high specificity and potency, the DHFR antibody is a valuable tool for studying cellular processes and developing targeted therapies.Anti-PGI antibody
The Anti-PGI antibody is a monoclonal antibody that targets and inhibits the growth factor PGI (Prostaglandin I2). It has been shown to reduce microvessel density in adipose tissue and inhibit the activity of fibronectin, a protein involved in cell adhesion and migration. This antibody also interacts with various other factors, including epidermal growth factor, E-cadherin, TGF-beta, oncostatin, and β-catenin. Its activation leads to the suppression of these factors, resulting in anti-inflammatory and anti-tumor effects. The Anti-PGI antibody is widely used in life sciences research for its ability to specifically target and neutralize PGI, making it an essential tool for studying the role of this growth factor in various biological processes.Purity:≥90% By Sds-PageCeruloplasmin antibody
Ceruloplasmin antibody is a highly specialized antibody used in Life Sciences research. It specifically targets ceruloplasmin, a protein involved in the regulation of copper concentrations in the body. This antibody is commonly used in studies related to cholinergic and dopamine pathways.EGFR antibody
The EGFR antibody is a monoclonal antibody that specifically targets the epidermal growth factor receptor (EGFR). It is commonly used in research and diagnostic applications to study the role of EGFR in various cellular processes. This antibody binds to the EGFR protein, inhibiting its activity and preventing downstream signaling pathways involved in cell proliferation, survival, and differentiation. The EGFR antibody has been shown to be effective in blocking the interaction between EGFR and its ligands, such as epidermal growth factor (EGF), resulting in reduced cell growth and migration. Additionally, this antibody can be used for immunohistochemistry and western blotting to detect the expression levels of EGFR in different tissues and cell types. With its high specificity and sensitivity, the EGFR antibody is an essential tool for understanding the function of EGFR in normal physiology and disease conditions.NP antibody
The NP antibody is a monoclonal antibody that specifically targets antiphospholipid antibodies. It is designed to recognize and bind to glycopeptides and glycoproteins associated with these autoantibodies. The NP antibody has cytotoxic properties and can be used for various applications in research and diagnostics.
V5 antibody
The V5 antibody is a growth factor that plays a crucial role in various biological processes. It is widely used in research and diagnostic applications, including electrophoresis and electrochemical impedance spectroscopy. This monoclonal antibody specifically targets the V5 epitope, making it an essential tool for detecting and quantifying proteins that are tagged with the V5 epitope. The V5 antibody has been extensively validated and proven to provide highly specific and reliable results. Its high affinity for the V5 epitope allows for sensitive detection even in complex samples such as human serum or collagen. Whether you're studying protein-protein interactions, investigating cellular signaling pathways, or developing new diagnostic assays, the V5 antibody is an invaluable resource in the field of life sciences. Trust its exceptional performance and superior quality to accelerate your research and advance scientific discovery.C14ORF174 antibody
C14ORF174 antibody was raised using the N terminal Of C14Orf174 corresponding to a region with amino acids FPSEKLGESLEETDLQPPKMTKPETPEETQRESTEKKRTEPPEQARLEFLCA125 antibody
The CA125 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the CA125 antigen, which is a protein found on the surface of certain cancer cells, including ovarian and breast cancer cells. The CA125 antibody has been extensively tested and validated for its ability to detect and bind to this specific antigen.Neurexophilin 4 antibody
Neurexophilin 4 antibody was raised using the N terminal of NXPH4 corresponding to a region with amino acids MRLLPEWFLLLFGPWLLRKAVSAQIPESGRPQYLGLRPAAAGAGAPGQQLV5 Tag antibody
The V5 Tag antibody is a highly specific monoclonal antibody that is widely used in Life Sciences research. It is commonly used to detect and quantify the expression of proteins tagged with the V5 epitope. This antibody recognizes the V5 epitope, which consists of five amino acids (GKPIPNPLLGLDST) and can be fused to the N- or C-terminus of a protein of interest.Troponin I antibody (Cardiac)
Troponin I antibody (cardiac) was raised in mouse using amino acid residues 25-40 of cTnI as the immunogen.PLAT antibody
The PLAT antibody is a specific antibody that targets activated E-cadherin. It is a monoclonal antibody commonly used in Life Sciences research. This antibody has been shown to react with interleukin-6 (IL-6) and helicobacter, making it a valuable tool for studying the role of these proteins in various biological processes. Additionally, the PLAT antibody can be used in polyclonal antibody assays, where it exhibits high specificity and sensitivity. Its colloidal gold-conjugated form allows for easy visualization and detection of target proteins. Furthermore, this antibody has been found to inhibit the growth factor IL-17A and may have potential therapeutic applications in autoimmune diseases associated with autoantibodies. Choose the PLAT antibody for reliable and accurate results in your research experiments.Phosphoserine and Phosphothreonine antibody
Rabbit polyclonal Phosphoserine and Phosphothreonine antibody
SCN5A antibody
SCN5A antibody was raised using the N terminal of SCN5A corresponding to a region with amino acids SEADFADDENSTAGESESHHTSLLVPWPLRRTSAQGQPSPGTSAPGHALHACD antibody
ACD antibody was raised using a synthetic peptide corresponding to a region with amino acids SSQPSPAICSAPATLTPRSPHASRTPSSPLQSCTPSLSPRSHVPSPHQALMAGEB1 antibody
MAGEB1 antibody was raised using the middle region of MAGEB1 corresponding to a region with amino acids QEKYLKYEQVPNSDPPRYQFLWGPRAYAETTKMKVLEFLAKMNGATPRDFgp64 protein antibody
The gp64 protein antibody is a growth factor that plays a crucial role in various biological processes. It has been shown to interact with extracellular histones, taxol, and cations, making it an essential component in cell signaling pathways. This antibody is commonly used in research and diagnostic applications to detect and quantify the presence of specific proteins or antigens. The gp64 protein antibody is a highly specific monoclonal antibody that binds to its target with high affinity, making it an excellent tool for studying protein-protein interactions. Additionally, this antibody has neutralizing properties against certain chemokines and interferons, further highlighting its potential therapeutic applications in the field of life sciences. With its ability to modulate protein kinase activity and activate phosphoinositide 3-kinase (PI3K), the gp64 protein antibody offers exciting opportunities for further research and development in various areas of biology and medicine.4EBP1 antibody
4EBP1 antibody was raised in Mouse using a purified recombinant fragment of 4E-BP1 expressed in E. coli as the immunogen.CEBPE antibody
CEBPE antibody was raised in mouse using recombinant Human Ccaat/Enhancer Binding Protein (C/Ebp), Epsilon (Cebpe)Influenza B Virus Nucleoprotein antibody
Influenza B Virus Nucleoprotein antibody was raised in Mouse using a purified recombinant fragment of Influenza B virus Nucleoprotein (stain:B/Lee/40) expressed in E. coli as the immunogen.RGS16 antibody
The RGS16 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets RGS16, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be highly effective in neutralizing RGS16 activity.PEPT1 antibody
The PEPT1 antibody is a highly specialized antibody that plays a crucial role in the field of life sciences. It is a polyclonal antibody that targets and neutralizes the growth factor known as colony-stimulating factor (CSF). This antibody has been extensively studied and proven to be effective in inhibiting the cytotoxic effects of CSF, making it a valuable tool in research and medical applications.
TMEM222 antibody
TMEM222 antibody was raised in rabbit using the C terminal of TMEM222 as the immunogenLAP3 antibody
LAP3 antibody was raised using the N terminal of LAP3 corresponding to a region with amino acids LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKENPCGF6 antibody
PCGF6 antibody was raised using the middle region of PCGF6 corresponding to a region with amino acids TQPLYNISANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQGSTA3 antibody
GSTA3 antibody was raised using the middle region of GSTA3 corresponding to a region with amino acids SSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRelF4E antibody
The elF4E antibody is a colloidal polyclonal antibody that has neutralizing properties. It targets the superoxide tyrosine, which is involved in various cellular processes such as chemokine signaling and kinase inhibition. This antibody can be used in assays related to life sciences, specifically in the study of TNF-α. In addition to its polyclonal form, there are also monoclonal antibodies available for specific targeting. The elF4E antibody has been extensively tested and validated using liver microsomes. It is a valuable tool for researchers in the field of life sciences who are studying various cellular processes and pathways.HIPK4 antibody
HIPK4 antibody was raised using the middle region of HIPK4 corresponding to a region with amino acids AEEKEAAGMGSVAGSSPFFREEKAPGMQRAIDQLDDLSLQEAGHGLWGETAnnexin A3 antibody
The Annexin A3 antibody is a highly specific monoclonal antibody that targets the annexin protein. This antibody is widely used in life sciences research to study the functions and interactions of annexins in various cellular processes. It can be conjugated with different markers, such as luminescent or fluorescent dyes, for visualization and detection purposes. The Annexin A3 antibody recognizes a specific amino acid site on the extracellular region of the annexin protein, making it an excellent tool for studying its expression and localization. Whether you're investigating cell signaling pathways or studying biomarkers, this Annexin A3 antibody is a valuable asset in your research arsenal.Secobarbital antibody
Barbiturate antibody was raised in mouse using secobarbital-5-KLH as the immunogen.PHF1 antibody
The PHF1 antibody is a specific antibody that is highly reactive to its recombinant antigen. It is commonly used in the field of Life Sciences for various applications such as immunohistochemistry, western blotting, and ELISA. The PHF1 antibody specifically targets proteins involved in the antigen-antibody reaction, including dopamine receptors, interleukin-6, inhibitory factors, β-catenin, protein kinases, leukemia inhibitory factors, oncostatin, and liver microsomes. This antibody is a valuable tool for researchers studying these proteins and their roles in various biological processes. Its high specificity and sensitivity make it an essential component in many scientific studies and experiments.SLC6A8 antibody
SLC6A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids CDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFCMTHFD2 antibody
MTHFD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATVTAntithrombin III antibody
Antithrombin III antibody was raised in sheep using human antithrombin purified from plasma as the immunogen.TAU antibody
The TAU antibody is a medicament that belongs to the class of monoclonal antibodies. It specifically targets and binds to the activated IL-1 receptor, inhibiting its activity and reducing inflammation. This monoclonal antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research areas. The TAU antibody is buffered to maintain stability and potency during storage and transportation. It can be used in experiments involving hybridization, immunohistochemistry, or Western blotting. This specific antibody has been isolated from human serum and is highly purified for optimal performance. Additionally, it has been tested for its specificity and functionality to ensure reliable results. Whether you are conducting research or developing therapeutic applications, the TAU antibody is an essential tool for your scientific endeavors.GAB2 antibody
The GAB2 antibody is a highly specialized product used in the field of Life Sciences. It plays a crucial role in various biological processes, including cation channel regulation and antigen-antibody reactions. This antibody specifically targets the activated form of platelet fibrinogen, which is essential for blood clotting.
GDF15 antibody
The GDF15 antibody is a highly effective monoclonal antibody that has neutralizing properties against prorenin. It is widely used in Life Sciences research and assays. This antibody specifically targets the CD20 antigen and has been proven to be highly effective in inhibiting its activity. Additionally, the GDF15 antibody has colloidal properties, making it easy to work with in laboratory settings. It also possesses inhibitory effects on glucose-6-phosphate and sclerostin, making it a versatile tool for various applications. With its high specificity and potency, the GDF15 antibody is a valuable asset for researchers working with antigens and seeking reliable results.Smad1 antibody
The Smad1 antibody is a highly specific monoclonal antibody that targets Smad1, a protein involved in cell signaling pathways. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.EphB2 antibody
EphB2 antibody was raised in Mouse using a purified recombinant fragment of EphB2(aa17-200) expressed in E. coli as the immunogen.RAI16 antibody
RAI16 antibody was raised using the N terminal of RAI16 corresponding to a region with amino acids HYYIESTDESTPAKKTDIPWRLKQMLDILVYEEQQQAAAGEAGPCLEYLLTGFBR1 antibody
The TGFBR1 antibody is a highly specialized monoclonal antibody that targets the tyrosine kinase receptor TGFBR1. This antibody is widely used in various life sciences assays to study the role of TGFBR1 in different cellular processes. It has been shown to be effective in detecting and quantifying TGFBR1 in nuclear extracts, making it an essential tool for researchers studying nuclear signaling pathways.SFRS7 antibody
SFRS7 antibody was raised using the N terminal of SFRS7 corresponding to a region with amino acids MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFA
Cdc27 Antibody
The Cdc27 Antibody is a highly specialized product in the field of Life Sciences. It is a Monoclonal Antibody that targets TNF-α, interferon, and anti-DNP antibodies. This antibody has the ability to induce lysis and neutralize globulin. Additionally, it has antiangiogenic properties and inhibits endothelial growth factor. The Cdc27 Antibody is also cytotoxic and can activate caspase-9, which plays a crucial role in apoptosis. With its wide range of applications and potent effects, this antibody is an essential tool for researchers in various fields of study.RNF31 antibody
RNF31 antibody was raised using the middle region of RNF31 corresponding to a region with amino acids SLINAHSLDPATLYEVEELETATERYLHVRPQPLAGEDPPAYQARLLQKLTMEFF2 antibody
The TMEFF2 antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that has been developed for research purposes. This antibody specifically targets TMEFF2, which is an antigen involved in various biological processes.POLR1D antibody
POLR1D antibody was raised in mouse using recombinant Human Polymerase (Rna) I Polypeptide D, 16Kda (Polr1D)Akt antibody
Akt, also known as Protein Kinase B (PKB), is a serine/threonine-specific protein kinase that plays a central role in various cellular processes. It's a key player in the PI3K/Akt/mTOR pathway, which is essential for regulating cell growth, survival, metabolism, and proliferation.Structure: Akt has three main isoforms in humans (Akt1, Akt2, and Akt3), each encoded by different genes. Activation: Akt activation is typically initiated by external signals, such as growth factors or insulin, that bind to cell surface receptors. This activates phosphoinositide 3-kinase (PI3K), which then produces phosphatidylinositol (3,4,5)-trisphosphate (PIP3) on the cell membrane. PIP3 then recruits Akt to the membrane where it is activated by two key phosphorylation events at Thr308 and Ser473. Once fully activated, Akt can move to different parts of the cell to phosphorylate its target proteins.The key functions of Akt include:Cell Survival and Anti-Apoptosis: Akt inhibits apoptosis by phosphorylating and inactivating several pro-apoptotic proteins, such as BAD and Caspase-9.Cell Growth and Proliferation: By promoting protein synthesis and inhibiting pathways that would otherwise halt the cell cycle, Akt encourages cell growth. It activates mTOR, a major regulator of protein synthesis and cellular growth.Metabolic Regulation: Akt influences metabolism by increasing glucose uptake and glycolysis, primarily through GLUT4 translocation and hexokinase activation, which is especially important in muscle and adipose tissues.Angiogenesis: Akt can stimulate the growth of new blood vessels by increasing the expression of VEGF (vascular endothelial growth factor), supporting tissue growth and repair.Cell Migration and Invasion: Akt is involved in processes that facilitate cell motility, aiding in wound healing and, unfortunately, in the spread of cancer cells.Given its role in promoting cell survival and growth, Akt is frequently hyperactivated in cancers, leading to uncontrolled cell division and tumor growth. Many cancer therapies target the PI3K/Akt/mTOR pathway to suppress this hyperactivity. Furthermore Akt's role in regulating glucose metabolism links it to insulin signaling. Defects in this pathway can impair glucose uptake, contributing to insulin resistance and type 2 diabetes.MOMA2 antibody (Mouse)
MOMA2 antibody (mouse) was raised in rat using mouse lymph node stroma as the immunogen.TOM20 antibody
The TOM20 antibody is a highly specific monoclonal antibody that targets the TOM20 protein. This protein is an essential component of the translocase of the outer mitochondrial membrane (TOM) complex, which is involved in the import of proteins into mitochondria. The TOM20 antibody has been widely used in research and diagnostic applications in the field of Life Sciences.KLKB1 antibody
The KLKB1 antibody is a highly effective medicament used in the field of life sciences. It is widely recognized for its ability to detect and analyze colony-stimulating factors in blood plasma. This Polyclonal Antibody has shown remarkable results in various research studies, including electrochemical impedance spectroscopy and cytometry analysis. Its reactive properties make it an ideal tool for investigating messenger RNA expression and leukocyte antigen activity. Additionally, the KLKB1 antibody has demonstrated cytotoxic effects on target cells, making it a valuable asset in the study of cellular mechanisms. With its adeno-associated viral delivery system, this antibody offers a promising avenue for therapeutic applications.
RLBP1L1 antibody
RLBP1L1 antibody was raised using the N terminal of RLBP1L1 corresponding to a region with amino acids NFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDILSTAT6 antibody
STAT6 antibody was raised in Mouse using a purified recombinant fragment of human STAT6 expressed in E. coli as the immunogen.EOMES antibody
The EOMES antibody is a highly specialized antibody used in Life Sciences research. It is a polyclonal antibody that specifically targets the Eomesodermin (EOMES) protein. EOMES plays a crucial role in the development and function of various cell types, including T cells, natural killer cells, and cytotoxic lymphocytes.TIMP2 antibody
The TIMP2 antibody is a highly effective tool in the field of Life Sciences. This antibody specifically targets and binds to TIMP2, an important protein involved in various cellular processes. It has been shown to inhibit the activity of MERTK, interferon, β-catenin, and annexin, making it a versatile tool for studying these pathways. Additionally, the TIMP2 antibody has antiviral and cytotoxic properties, making it useful for research on viral infections and cancer. With its high specificity and affinity, this antibody is an essential component in any laboratory studying growth factors and activated signaling pathways.SNRPF antibody
SNRPF antibody was raised using the middle region of SNRPF corresponding to a region with amino acids GYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRECNOT6 antibody
CNOT6 antibody was raised using the N terminal of CNOT6 corresponding to a region with amino acids EISGKVRSLSASLWSLTHLTALHLSDNSLSRIPSDIAKLHNLVYLDLSSNALS2 antibody
ALS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALRGMSDLPPYGSGSSVQRQEPPISRSAKYTFYKDPRLKDATYDGRWLSGHuman Growth Hormone antibody
Human growth hormone antibody was raised in mouse using human pituitary GH as the immunogen.
IPPK antibody
IPPK antibody was raised using the middle region of IPPK corresponding to a region with amino acids KTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQIDGPYDEAFYQK
ROCK1 antibody
The ROCK1 antibody is a highly specific monoclonal antibody that targets the protein ROCK1. This protein plays a crucial role in various cellular processes, including cell growth, migration, and proliferation. By inhibiting the activity of ROCK1, this antibody can effectively block the signaling pathway associated with growth factors and histidine kinases.RBPMS antibody
RBPMS antibody was raised using the middle region of RBPMS corresponding to a region with amino acids PASLHAQCFSPEAKPNTPVFCPLLQQIRFVSGNVFVTYQPTADQQRELPCClock antibody
The Clock antibody is a monoclonal antibody that belongs to the field of Life Sciences. It is specifically designed for neuroprotective purposes and is highly effective in targeting and neutralizing the Clock protein. This antibody has been extensively tested and proven to have high affinity and specificity for its target. It can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. The Clock antibody is colloidal gold-conjugated, making it easy to detect with a simple color change reaction. It has also been shown to inhibit the activity of growth factors like endothelial growth factor and glucagon, making it a valuable tool in studying cellular signaling pathways. With its superior performance and reliability, this antibody is an essential component for any research or diagnostic project related to circadian rhythm regulation or clock genes.
GABRG2 antibody
GABRG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPAPTIDIR
SAAL1 antibody
SAAL1 antibody was raised using the N terminal of SAAL1 corresponding to a region with amino acids MDRNPSPPPPGRDKEEEEEVAGGDCIGSTVYSKHWLFGVLSGLIQIVSPEMUC1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to treat tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. The effectiveness of this drug has been demonstrated using advanced techniques like the patch-clamp technique on human erythrocytes.
ING1 antibody
The ING1 antibody is a polyclonal antibody that specifically targets the colony-stimulating factor known as acidic m-CSF. It is widely used in life sciences research for its ability to detect and measure the levels of this important protein. The ING1 antibody has been extensively tested and validated for its high specificity and sensitivity, making it a reliable tool for researchers studying the role of colony-stimulating factors in various biological processes.
Annexin A11 antibody
Annexin A11 antibody was raised using the C terminal of ANXA11 corresponding to a region with amino acids RIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTSGDYRKILLKICGGNDMKK6 antibody
The MKK6 antibody is a basic protein used in Life Sciences research. It is an essential tool for studying various cellular processes and pathways. This antibody can be used in experiments involving electrodes, as it forms disulfide bonds with target molecules, allowing for precise detection and analysis. The MKK6 antibody has been shown to have drug-like properties, making it an excellent candidate for developing therapeutic antibodies. It has also been found to interact with collagen and colloidal particles, further expanding its potential applications. Additionally, this antibody exhibits cytotoxic effects and can induce apoptosis through the tumor necrosis factor-related apoptosis-inducing (TNF-related apoptosis-inducing) pathway. Its binding affinity to CD3 receptors and alpha-fetoprotein makes it a valuable tool in immunological studies. The MKK6 antibody is highly specific and shows minimal cross-reactivity with other proteins present in human serum.
CYP17A1 antibody
The CYP17A1 antibody is a monoclonal antibody that specifically targets the human serum. It is commonly used in research and diagnostic laboratories to detect and measure the levels of CYP17A1, a growth factor that plays a crucial role in various physiological processes. This monoclonal antibody has been extensively characterized and validated for its specificity and sensitivity.NLRP1 antibody
NLRP1 antibody was raised using the N terminal of NLRP1 corresponding to a region with amino acids DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCRELRabbit anti Mouse IgG2b (Texas Red)
Rabbit anti-mouse IgG2b was raised in rabbit using murine IgG2b heavy chain as the immunogen.
WNT5A antibody
WNT5A antibody was raised in Mouse using a purified recombinant fragment of WNT5A expressed in E. coli as the immunogen.Aflatoxin antibody
The Aflatoxin antibody is a monoclonal antibody that specifically targets aflatoxins, which are toxic compounds produced by certain types of fungi. This antibody has been extensively studied in the field of Life Sciences and has shown excellent binding affinity to aflatoxins. It can be used in various applications such as ELISA assays, immunohistochemistry, and Western blotting.RPL10A antibody
RPL10A antibody was raised using the middle region of RPL10A corresponding to a region with amino acids YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKPI16 antibody
The PI16 antibody is a highly specialized monoclonal antibody that targets protein kinase activity. It has been extensively researched and proven to exhibit cytotoxic effects on various cell types. This antibody is widely used in the field of Life Sciences, particularly in studies involving antibodies and their role in cellular processes. The PI16 antibody specifically recognizes and binds to non-phosphorylated protein isoforms, such as β-catenin, which are involved in key signaling pathways. Its activation leads to a cascade of events that ultimately result in cellular responses. Additionally, this antibody has shown reactivity towards glutamate receptors and has been found to modulate their function. With its unique properties, the PI16 antibody is an invaluable tool for researchers working with pluripotent cells and studying autoantibodies.SURF6 antibody
SURF6 antibody was raised using the middle region of SURF6 corresponding to a region with amino acids EPREPPGLIFNKVEVSEDEPASKAQRRKEKRQRVKGNLTPLTGRNYRQLLSEC31A antibody
The SEC31A antibody is a highly specialized monoclonal antibody that targets the SEC31A protein. This protein plays a crucial role in cell function and is involved in various processes such as lipoprotein lipase, multidrug resistance, retinoid metabolism, collagen synthesis, and growth factor signaling.ENOX1 antibody
ENOX1 antibody was raised using the middle region of ENOX1 corresponding to a region with amino acids QQLQFLQQTMQGMQQQLLTIQEELNNKKSELEQAKEEQSHTQALLKVLQERNH1 antibody
RNH1 antibody was raised using the middle region of RNH1 corresponding to a region with amino acids LLHPSSRLRTLWIWECGITAKGCGDLCRVLRAKESLKELSLAGNELGDEG
FBXO16 antibody
FBXO16 antibody was raised using the C terminal of FBXO16 corresponding to a region with amino acids SPLSAFRSSSSLRKKNNSGEKALPPWRSSDKHPTDIIRFNYLDNRDPMET
TSH antibody
TSH antibody is a monoclonal antibody that specifically targets and neutralizes galectin-3-binding. It is an activated, low-density antibody that has been extensively studied in the field of Life Sciences. TSH antibody has shown promising results in interfering with collagen production, making it a potential therapeutic agent for conditions related to collagen dysregulation. Additionally, this antibody has demonstrated its ability to inhibit the glycation process and reduce the levels of interleukin-6, a pro-inflammatory cytokine. Furthermore, TSH antibody has been proven effective in bioassays targeting fatty acid metabolism. With its unique characteristics and potent bioactivity, TSH antibody holds great promise for future research and clinical applications.Tropomyosin antibody
Tropomyosin antibody is a glycopeptide used in Life Sciences research. It is a monoclonal antibody that specifically targets the CD33 protein. This antibody is commonly used in studies involving Monoclonal Antibodies and Antibodies to investigate the role of CD33 in various biological processes. Tropomyosin antibody has been shown to have neutralizing effects on colony-stimulating factors, which are important for regulating cell growth and differentiation. Additionally, it has been found to bind to proteins involved in blood clotting, such as fibrinogen, suggesting potential anticoagulant properties. The glycosylation of this antibody enhances its stability and binding affinity, making it an excellent tool for researchers studying CD33-related pathways.VASP antibody
The VASP antibody is a highly reactive antibody that specifically targets interleukin-6 (IL-6). It is derived from an expression plasmid and belongs to the class of monoclonal antibodies. This antibody has been extensively used in Life Sciences research to study the expression and function of IL-6 in various biological systems.
HSPB2 antibody
HSPB2 antibody was raised using the middle region of HSPB2 corresponding to a region with amino acids VRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVE
