Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
Myosin Ie antibody
Myosin Ie antibody was raised using the middle region of MYO1E corresponding to a region with amino acids PKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGRLAT antibody
The LAT antibody is a monoclonal antibody that is derived from hybridoma cells. It is used as an anti-connexin agent and can be used to detect autoantibodies in various biological samples. This antibody specifically targets endothelial growth factor and can be used for research purposes in the field of angiogenesis. Additionally, the LAT antibody has been shown to inhibit telomerase activity and can serve as a potential therapeutic agent for cancer treatment. It is available in a colloidal microsphere format and can be easily conjugated with other molecules for specific applications. With its high specificity and sensitivity, the LAT antibody is a valuable tool for studying signaling pathways and cellular processes involving phosphorylcholine.
Matrilin 2 antibody
Matrilin 2 antibody was raised using the middle region of MATN2 corresponding to a region with amino acids AVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALEDNa+ Ca2+ Exchanger antibody (cardiac)
Na+ Ca2+ exchanger antibody (cardiac) was raised in rabbit using canine cardiac sarcolemma Na+/Ca2+ exchanger as the immunogen.PRDM1 antibody
PRDM1 antibody was raised in Mouse using a purified recombinant fragment of human PRDM1 expressed in E. coli as the immunogen.Thrombomodulin antibody
Thrombomodulin antibody is a monoclonal antibody that specifically targets thrombomodulin, an extracellular protein involved in blood coagulation and inflammation. This antibody has cytotoxic effects on cells expressing alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's disease. It has been shown to reduce microvessel density and inhibit the formation of actin filaments in vitro. Thrombomodulin antibody can be used in life sciences research to study the role of thrombomodulin in various biological processes and as a potential therapeutic agent for conditions involving abnormal blood clotting or inflammation.IFRD1 antibody
IFRD1 antibody was raised using the middle region of IFRD1 corresponding to a region with amino acids LALLFELARGIESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVF
LHX2 antibody
The LHX2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It acts as a neutralizing agent against a specific antigen, targeting low-density lipoprotein (LDL) receptors. This soluble antibody binds to LDL receptors and prevents the uptake of LDL particles into cells. By blocking this process, it helps researchers study the role of LDL receptors in various biological processes.SSB antibody
The SSB antibody is a specific antibody that belongs to the class of monoclonal antibodies. It has neutralizing properties and can be used in various applications in the field of Life Sciences. This antibody is commonly used in research to study the function of SSB (single-stranded DNA-binding protein) and its role in various biological processes.LMO1 antibody
LMO1 antibody was raised in mouse using recombinant Human Lim Domain Only 1 (Rhombotin 1)TRPM5 antibody
TRPM5 antibody was raised using the N terminal of TRPM5 corresponding to a region with amino acids AAPWLILVGSGGIADVLAALVNQPHLLVPKVAEKQFKEKFPSKHFSWEDICPEB2 antibody
CPEB2 antibody was raised using the N terminal of CPEB2 corresponding to a region with amino acids FLQQRNSYNHHQPLLKQSPWSNHQSSGWGTGSMSWGAMHGRDHRRTGNMGArginase 1 antibody
The Arginase 1 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets arginase, an enzyme involved in the metabolism of arginine. This antibody can be used for various applications, including immunohistochemistry, western blotting, and ELISA.SSX1 antibody
The SSX1 antibody is a highly specialized monoclonal antibody used in the field of life sciences. It targets and binds to the activated form of SSX1, a methyl transferase enzyme involved in various cellular processes. This antibody is designed to specifically recognize and bind to the phosphorylation site on SSX1, allowing for precise detection and analysis.
Goat anti Armenian Hamster IgG (H + L) (FITC)
Goat anti-armenian hamster IgG (H + L) (FITC) was raised in goat using hamster IgG (H & L) as the immunogen.THG1L antibody
THG1L antibody was raised using a synthetic peptide corresponding to a region with amino acids DCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINYVRK2 antibody
The VRK2 antibody is a highly specialized bioassay tool used in Life Sciences research. This antibody is designed to specifically target and bind to VRK2, a growth factor involved in various cellular processes. It has been extensively tested and validated for its efficacy in detecting VRK2 in samples such as blood plasma or cell lysates.LYVE1 antibody
The LYVE1 antibody is a monoclonal antibody that specifically targets estrogen receptors. It has been shown to be highly effective in binding to activated estrogen receptors and blocking their activity. This antibody also has the ability to inhibit the production of interleukin-6, a pro-inflammatory cytokine that plays a role in various diseases.CLDN6 antibody
The CLDN6 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets the epidermal growth factor and plays a crucial role in various biological processes. This polyclonal antibody has been extensively tested and proven to be effective in detecting CLDN6 protein expression.CASQ2 antibody
CASQ2 antibody was raised in mouse using recombinant human CASQ2 (20-399aa) purified from E. coli as the immunogen.C2ORF42 antibody
C2ORF42 antibody was raised using the C terminal Of C2Orf42 corresponding to a region with amino acids ITRSFIQNRDGTYELFKCPKVEVESIAETYGRIEKQPVLRPLELKTFLKVSSTR1 antibody
The SSTR1 antibody is a powerful detection reagent that belongs to the class of polyclonal antibodies. It is widely used in the field of life sciences as a biomarker for various research applications. The SSTR1 antibody specifically targets and binds to the SSTR1 protein, inhibiting its activity and preventing cell proliferation. This antibody is highly effective in inhibiting the growth of cancer cells and has been extensively studied as a potential therapeutic agent. In addition to its anti-proliferative properties, the SSTR1 antibody can also be used as a diagnostic tool to detect the presence of autoantibodies in patient samples. Its versatility and reliability make it an indispensable tool for researchers in the field of molecular biology and medicine.DQX1 antibody
DQX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRFCWDRLLLQEVASTRGTGAWGVLVLDEAQERSVASDSLQGLLQDARLEEFEMP1 antibody
The EFEMP1 antibody is a powerful tool used in the field of life sciences. This antibody specifically targets human folate and actin, making it ideal for various research applications. It has been shown to interfere with the growth factor signaling pathways and inhibit endogenous hematopoietic activity. The EFEMP1 antibody is available in both monoclonal and polyclonal forms, providing researchers with flexibility in their experimental design. Additionally, this antibody has been extensively validated and is widely used in the scientific community. With its ability to bind to actin filaments, it enables researchers to study actin dynamics and cellular processes involving actin. Whether you are studying cell biology, immunology, or any other related field, the EFEMP1 antibody is an essential tool that will enhance your research outcomes.STAT3 antibody
The STAT3 antibody is a growth factor that belongs to the class of monoclonal antibodies. It specifically targets and binds to STAT3, a protein involved in cell signaling pathways. This antibody has been extensively studied in the field of life sciences and has shown promising results in various research applications. It has been used to study the role of STAT3 in cancer, inflammation, and immune responses. The STAT3 antibody can also be used as a tool for detecting the presence of STAT3 in cells or tissues. With its high specificity and affinity, this antibody provides reliable and accurate results. Whether you are conducting experiments or performing diagnostic tests, the STAT3 antibody is an essential tool for your research needs.CDK2 antibody
The CDK2 antibody is a highly specific monoclonal antibody that targets the cyclin-dependent kinase 2 (CDK2) protein. CDK2 is a key regulator of cell cycle progression and plays a crucial role in cell division and proliferation. This antibody recognizes and binds to the antigen site on CDK2, inhibiting its activity and preventing the growth and replication of cancer cells.Streptococcus pneumoniae antibody
The Streptococcus pneumoniae antibody is a neuroprotective monoclonal antibody that has the ability to neutralize the harmful effects of this bacterium. It works by binding to specific glycoproteins on the surface of Streptococcus pneumoniae, preventing its attachment and subsequent invasion of host cells. This antibody has been shown to be effective in preventing the denaturation of proteins caused by Streptococcus pneumoniae infection. Additionally, it has been found to have potential therapeutic applications in hormone-related disorders, as it can bind to estrogen receptors and modulate their activity. With its high specificity and recombination capabilities, this antibody holds promise in the field of Life Sciences for the development of targeted therapies against Streptococcus pneumoniae infections.Chk2 antibody
The Chk2 antibody is a polyclonal antibody that specifically targets the Chk2 protein. Chk2 is a serine/threonine kinase that plays a crucial role in cell cycle regulation and DNA damage response. This antibody recognizes an epitope located within the acid residues of the Chk2 protein, making it highly specific for its target.PDCD4 antibody
The PDCD4 antibody is a highly specialized antibody that targets the protein phosphatase 2A (PP2A), which plays a crucial role in regulating cellular processes such as cell growth, proliferation, and apoptosis. This antibody is available in both polyclonal and monoclonal forms, allowing for flexibility in experimental design.
CYP1A2 antibody
The CYP1A2 antibody is a monoclonal antibody that specifically targets and inhibits the activity of the human cytochrome P450 enzyme 1A2. This enzyme is primarily found in liver microsomes and plays a crucial role in the metabolism of various drugs and xenobiotics. By blocking the action of CYP1A2, this antibody can modulate drug metabolism and potentially enhance therapeutic efficacy.MYL9 antibody
The MYL9 antibody is a highly specialized monoclonal antibody that targets the myosin light chain 9 (MYL9) protein. This protein plays a crucial role in various cellular processes, including cell growth, apoptosis, and cytoskeletal organization. The MYL9 antibody specifically binds to MYL9 and inhibits its activity, leading to a cascade of downstream effects.Tektin 4 antibody
Tektin 4 antibody was raised using the N terminal of TEKT4 corresponding to a region with amino acids LATETQALAQRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLA
PSMB1 antibody
PSMB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGmTOR antibody
The mTOR antibody is a highly specialized polyclonal antibody that targets the mammalian target of rapamycin (mTOR). This protein plays a crucial role in regulating cell growth, proliferation, and survival. The mTOR antibody specifically recognizes and binds to mTOR, inhibiting its activity and preventing downstream signaling pathways.MRPL13 antibody
MRPL13 antibody was raised using the middle region of MRPL13 corresponding to a region with amino acids AIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLDVasohibin 1 antibody
Vasohibin 1 antibody was raised using the N terminal of VASH1 corresponding to a region with amino acids ATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERTIMP1 antibody
The TIMP1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets epidermal growth factor and plays a crucial role in regulating cell growth and proliferation. This antibody has been extensively studied for its ability to inhibit the activity of enzymes such as histidine and choline acetyltransferase, which are involved in various cellular processes. Additionally, the TIMP1 antibody has been shown to have potential therapeutic applications in treating thrombocytopenia and certain types of cancers, including prostate cancer (androgen-sensitive and castration-resistant) and breast cancer (MCF-7 cell line). Its high specificity and affinity make it an essential tool for researchers conducting assays and studying the mechanisms of action of growth factors in human serum.CD8a antibody
The CD8a antibody is a highly versatile and potent family kinase inhibitor that plays a crucial role in various biological processes. It is commonly used in Life Sciences research and has been proven to have significant effects on growth factors, interferons, and cytotoxic activities. This antibody specifically targets CD8a, a cell surface glycoprotein expressed by cytotoxic T cells and natural killer cells.AP2B1 antibody
AP2B1 antibody was raised using the C terminal of AP2B1 corresponding to a region with amino acids GAVDLLGGGLDSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVMARK antibody
The MARK antibody is a highly specialized monoclonal antibody that targets choline acetyltransferase (ChAT), an enzyme involved in the synthesis of the neurotransmitter acetylcholine. This antibody specifically recognizes and binds to ChAT, allowing for the detection and quantification of ChAT levels in various biological samples.FHL1 antibody
The FHL1 antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets FHL1, a protein involved in various biological processes. This antibody has been extensively studied and proven to have high specificity and sensitivity in detecting FHL1 in human serum and tissue samples.p53 antibody
The p53 antibody is a highly specialized product used in Life Sciences research. It is a polyclonal antibody that specifically targets the p53 protein, which plays a crucial role in cell cycle regulation and tumor suppression. This antibody is designed to detect and neutralize p53, making it an essential tool for studying the function and activity of this important target molecule.ABCG1 antibody
The ABCG1 antibody is a monoclonal antibody that specifically targets the ABCG1 protein, which is involved in the regulation of cholesterol metabolism. This antibody has been shown to inhibit the activity of ABCG1 and reduce cholesterol efflux from adipose tissue. It can also be used in assays to detect the presence of ABCG1 in human serum or other samples. The ABCG1 antibody has cytotoxic effects on cells expressing high levels of the target molecule and may be useful for therapeutic applications in diseases related to cholesterol metabolism, such as atherosclerosis. Additionally, this antibody can be used in research and development within the field of Life Sciences, particularly in studies involving collagen and urokinase plasminogen activator.METTL2B antibody
METTL2B antibody was raised using the N terminal of METTL2B corresponding to a region with amino acids AGSYPEGAPAILADKRQQFGSRFLSDPARVFHHNAWDNVEWSEEQAAAAECHAC2 antibody
CHAC2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVIL5 antibody
The IL5 antibody is a powerful tool in the field of immunology. It specifically targets and neutralizes interleukin-5 (IL-5), a chemokine that plays a crucial role in allergic and inflammatory responses. The IL5 antibody works by binding to IL-5, preventing it from interacting with its receptors and initiating downstream signaling pathways.PARP antibody
The PARP antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in detecting and studying the function of poly(ADP-ribose) polymerase (PARP), an enzyme involved in DNA repair and cell death pathways. This antibody specifically targets PARP, allowing for precise detection and analysis of its activity.OPTN antibody
The OPTN antibody is a highly specialized monoclonal antibody that has been developed for research purposes in the field of Life Sciences. This antibody has shown neutralizing effects against growth factors such as epidermal growth factor and TGF-beta, making it a valuable tool for studying their biological functions. Additionally, the OPTN antibody has been found to interact with vasoactive intestinal peptide and low-molecular-weight molecules like transferrin, further expanding its potential applications in various experimental settings.ACTA1 antibody
The ACTA1 antibody is a polyclonal antibody that specifically targets the ACTA1 protein. This protein plays a crucial role in muscle contraction and is found predominantly in skeletal muscle fibers. The ACTA1 antibody can be used for various applications, including immunohistochemistry, western blotting, and ELISA. It has been validated for use in human serum samples and has shown high specificity and sensitivity.
LSM1 antibody
LSM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEMMP2 antibody
The MMP2 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to matrix metalloproteinase 2 (MMP2), an enzyme that plays a crucial role in tissue remodeling and cell migration. This antibody has been widely used in studies related to cancer, as MMP2 is known to be involved in tumor invasion and metastasis.C2ORF53 antibody
C2ORF53 antibody was raised using the middle region of C2Orf53 corresponding to a region with amino acids PQGKATQACGHQLPASQPPAAQARADPVPGTPSQTRSFRSAGLQSPNSPRB71 antibody
The B71 antibody is a monoclonal antibody that plays a crucial role in various biological processes. It specifically targets the B7-1 protein, which is involved in immune responses and cell signaling. This antibody can be used in research and diagnostic applications to study the expression and function of B7-1. The B71 antibody has been widely used in the field of life sciences to investigate the role of B7-1 in diseases such as cancer, autoimmune disorders, and infectious diseases. Its high specificity and affinity make it an invaluable tool for researchers studying immune regulation and therapeutic development. Whether you're working on basic research or developing new therapies, the B71 antibody is an essential resource for your studies.
PRMT5 antibody
PRMT5 antibody was raised using the N terminal of PRMT5 corresponding to a region with amino acids FDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSOR8D1 antibody
The OR8D1 antibody is a monoclonal antibody that has shown promising results in various studies. It has been found to have neutralizing effects on phorbol-induced cell proliferation in carcinoma cell lines. Additionally, this antibody has been extensively used in polymerase chain reaction (PCR) experiments in Life Sciences research.CD61 antibody
The CD61 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to the CD61 protein, which is found on the surface of certain cells. This antibody has been extensively studied for its cytotoxic and nephrotoxic properties, making it a valuable tool for research purposes.ASS1 antibody
The ASS1 antibody is a monoclonal antibody that targets the argininosuccinate synthase 1 (ASS1) protein. This protein plays a crucial role in the production of arginine, an amino acid that is essential for various biological processes. The ASS1 antibody can be used in research and diagnostic applications to study the expression and localization of ASS1 in different tissues and cell types.Parkin antibody
The Parkin antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets the Parkin protein, which plays a crucial role in cellular processes such as adiponectin regulation and growth factor signaling. This antibody has been extensively validated for use in various applications, including Western blotting, immunohistochemistry, and ELISA.
SMS antibody
The SMS antibody is a highly specialized monoclonal antibody that has lysine-specific and neutralizing properties. This antibody targets the IFN-gamma growth factor, which plays a crucial role in regulating immune responses. By specifically binding to IFN-gamma, the SMS antibody can modulate its activity and potentially inhibit its effects.
FHL2 antibody
The FHL2 antibody is a powerful tool in the field of life sciences. It is an anti-CD33 antibody that has antiviral properties and can be used to neutralize the effects of certain viruses. This monoclonal antibody specifically targets CD33, a cell surface receptor involved in immune responses. By binding to CD33, the FHL2 antibody can block its interaction with other molecules, preventing viral entry into host cells.TGS1 antibody
TGS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDENPASDFDDSGSLLGFKYGSGQKYGGIPNFSHRQVRYLEKNVKLKSKYCBP80 antibody
The CBP80 antibody is a protein that specifically targets and binds to the CBP80 protein. It has been shown to have autoantibodies against basic proteins and TNF-related apoptosis-inducing ligand (TRAIL), which are growth factors involved in cell death regulation. The CBP80 antibody can be used in various research applications, such as immunohistochemistry, Western blotting, and ELISA assays. It is commonly used to detect the presence of specific proteins in biological samples, including human serum or tissue extracts. This antibody is a valuable tool for researchers in the life sciences field who are studying various target molecules, such as alpha-fetoprotein or erythropoietin.
Carbonic Anhydrase VIII antibody
Carbonic Anhydrase VIII antibody was raised using the N terminal of CA8 corresponding to a region with amino acids YEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCTubulin antibody
Tubulin antibody was raised in mouse using Chicken skeletal muscle cell preparation as the immunogen.GLUT1 antibody
The GLUT1 antibody is a highly specialized antibody that plays a crucial role in sugar transport across cell membranes. It is commonly used in various scientific and medical research applications. This antibody specifically targets the glucose transporter protein 1 (GLUT1), which is responsible for transporting glucose into cells.KLH antibody
The KLH antibody is a highly specialized protein that plays a crucial role in various biological processes. It is an essential component of the transferrin and DNA aptamer systems, which are responsible for transporting molecules and regulating gene expression, respectively. Additionally, the KLH antibody has been shown to interact with TGF-β1, a key signaling molecule involved in cell growth and differentiation.C18ORF54 antibody
C18ORF54 antibody was raised using a synthetic peptide corresponding to a region with amino acids PCSLDKLEADRSWENIPVTFKSPVPVNSDDSPQQTSRAKSAKGVLEDFLNTrichomonas vaginalis antibody
Trichomonas vaginalis antibody was raised in mouse using Trichomonas vaginalis as the immunogen.Lp-PLA2 antibody
The Lp-PLA2 antibody is a protein that plays a crucial role in various biological processes related to Life Sciences. It has been shown to be involved in fas-mediated apoptosis, the regulation of interleukin-6 production, and the organization of actin filaments. Additionally, this antibody exhibits phosphatase activity and has been found to interact with collagen and fibrinogen.
MNT antibody
The MNT antibody is a growth factor that has applications in Life Sciences. It is a monoclonal antibody that specifically targets human serum proteins. The MNT antibody is designed to recognize and bind to specific antigen-antibody reactions, allowing for the detection and analysis of various human proteins. This antibody contains specific amino acid residues that enable it to bind to dopamine and copper concentrations, making it useful for studying these substances in biological samples. Additionally, the MNT antibody can be used in cytotoxic assays and immobilization techniques. Its high specificity and affinity make it an excellent tool for researchers working with antibodies and autoantibodies.RB1 antibody
The RB1 antibody is a highly specialized monoclonal antibody that targets glycan dimers. It specifically recognizes and binds to the glycopeptide region of these dimers, which plays a crucial role in various biological processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in neutralizing the activity of chemokines, including TNF-α.
DHX30 antibody
DHX30 antibody was raised using a synthetic peptide corresponding to a region with amino acids AASRDLLKEFPQPKNLLNSVIGRALGISHAKDKLVYVHTNGPKKKKVTLHCYB5R3 antibody
The CYB5R3 antibody is a polyclonal antibody that is activated to target specific proteins involved in various biological processes. It has been extensively used in life sciences research to study the effects of these proteins on different cell types. This antibody has shown promising results in neutralizing the activity of TNF-α, a pro-inflammatory cytokine, and TGF-β1, a growth factor involved in tissue repair and fibrosis. Additionally, it has been used as an immobilization agent for neurotrophic factors and nuclear proteins. The CYB5R3 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific needs. Its high specificity and affinity make it a valuable tool for studying protein-protein interactions and identifying potential therapeutic targets.TNFRSF9 antibody
The TNFRSF9 antibody is an active agent in the field of Life Sciences and is widely used as a serum marker. It specifically targets mesothelin, a glycoprotein that is often overexpressed in certain types of cancer. This antibody has been shown to inhibit the activity of telomerase, an enzyme involved in cell division and immortalization. Additionally, it has been found to modulate the expression of interferon-stimulated genes and interfere with the function of glycogen synthase kinase. The TNFRSF9 antibody is commonly used in research laboratories for various applications, including immunohistochemistry, Western blotting, and flow cytometry. With its high-flux binding capacity and specificity, this polyclonal antibody offers a valuable tool for scientists studying cellular processes and developing new therapeutic strategies.H1FOO antibody
H1FOO antibody was raised using the middle region of H1FOO corresponding to a region with amino acids KAPKAGQGPNTKAAAPAKGSGSKVVPAHLSRKTEAPKGPRKAGLPIKASSCLDN19 antibody
The CLDN19 antibody is a glycation-specific polyclonal antibody that targets fatty acids. It is designed to bind to specific interleukin-6 receptors and promote endocytic uptake of growth factors. This antibody can be used in various life science applications, including research and diagnostics. It exhibits high specificity and affinity for its target, making it an ideal tool for studying the role of interleukin-6 in cellular processes. Additionally, monoclonal antibodies derived from the CLDN19 antibody have been shown to have neutralizing effects on interferon activity and collagen synthesis. With its unique properties and wide range of applications, the CLDN19 antibody is a valuable asset in the field of Life Sciences.TGFBR2 antibody
The TGFBR2 antibody is a polyclonal antibody that specifically targets the transforming growth factor beta receptor 2 (TGFBR2). It is commonly used in research and diagnostic applications to detect and quantify the expression of TGFBR2. This antibody binds to the activated form of TGFBR2, inhibiting its interaction with other proteins involved in signal transduction pathways. Additionally, it has been shown to block the binding of interferon-gamma (IFN-gamma) to TGFBR2, suggesting a potential role in modulating immune responses. The TGFBR2 antibody is available as both monoclonal and polyclonal forms, providing researchers with options for their specific experimental needs. Its high specificity and sensitivity make it a valuable tool for studying the function and regulation of TGFBR2 in various biological systems.
RORA antibody
The RORA antibody is a highly specialized antibody that targets the retinoid-related orphan receptor alpha (RORA). This receptor plays a crucial role in regulating gene expression and is involved in various biological processes, including immune response, metabolism, and circadian rhythm. The RORA antibody can be used for research purposes in the field of life sciences to study the function and activity of this important receptor.FOXN1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection and contains active compounds known for their bactericidal activity. Through its unique mechanism, this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has been conducted using the patch-clamp technique on human erythrocytes, demonstrating its high efficacy in human subjects.HDAC10 antibody
The HDAC10 antibody is a highly specific monoclonal antibody that targets the histone deacetylase 10 (HDAC10) protein. HDAC10 is a member of the histone deacetylase family that plays a crucial role in gene expression regulation. This antibody is widely used in Life Sciences research to study the function and activity of HDAC10.
ALDH1B1 antibody
The ALDH1B1 antibody is a highly specialized antibody used in Life Sciences research. It is designed to target and inhibit the activity of the ALDH1B1 enzyme, which plays a crucial role in the metabolism of tyrosine. By blocking this enzyme, the ALDH1B1 antibody can be used to study the effects of tyrosine inhibition on various cellular processes.
GNL3 antibody
GNL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPNSAPFKEALLRCytokeratin 7 antibody
Cytokeratin 7 antibody was raised using the N terminal of KRT7 corresponding to a region with amino acids SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAV
FECH antibody
FECH antibody was raised using a synthetic peptide corresponding to a region with amino acids LDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMSLCO6A1 antibody
SLCO6A1 antibody was raised using the C terminal of SLCO6A1 corresponding to a region with amino acids LAMTRVVPDKLRSLALGVSYVILRIFGTIPGPSIFKMSGETSCILRDVNKMatrin 3 antibody
Matrin 3 antibody was raised using the N terminal of MATR3 corresponding to a region with amino acids MSKSFQQSSLSRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTAHDAC10 antibody
The HDAC10 antibody is a growth factor that belongs to the class of Monoclonal Antibodies. It acts as a protein kinase inhibitor and exhibits antiangiogenic properties. This antibody specifically targets epidermal growth factor (EGF) and inhibits its activity. It has been shown to block the activation of the EGF receptor, preventing downstream signaling pathways involved in cell proliferation and survival. The HDAC10 antibody can also bind to erythropoietin (EPO) and inhibit its cytotoxic effects. This monoclonal antibody is widely used in Life Sciences research for studying the role of EGF and EPO in various cellular processes. Its specificity and high affinity make it an excellent tool for investigating the mechanisms of action of growth factors and their receptors.
