Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75562 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
RELB antibody
RELB antibody was raised using the C terminal of RELB corresponding to a region with amino acids GPEPLTLDSYQAPGPGDGGTASLVGSNMFPNHYREAAFGGGLLSPGPEATKCNK10 antibody
KCNK10 antibody was raised using the C terminal of KCNK10 corresponding to a region with amino acids EDVQKIYKTFRNYSLDEEKKEEETEKMCNSDNSSTAMLTDCIQQHAELENREG4 antibody
The REG4 antibody is a highly specialized monoclonal antibody that targets the REG4 protein. This antibody complex has been shown to neutralize the activity of REG4, which plays a crucial role in various biological processes. It has been observed that REG4 promotes the production of interleukin-6 (IL-6), a pro-inflammatory cytokine, and stimulates lipid peroxidation in cells.
CRLF2 antibody
CRLF2 antibody was raised using the middle region of CRLF2 corresponding to a region with amino acids FWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKFOCT4 antibody
The OCT4 antibody is a highly specialized antibody used in the field of Life Sciences. It is specifically designed to target and bind to OCT4, a protein that plays a crucial role in the regulation of stem cell pluripotency. This antibody has been extensively tested and validated for use in various applications, including immunofluorescence, immunohistochemistry, and Western blotting.SHPRH antibody
SHPRH antibody was raised using the N terminal of SHPRH corresponding to a region with amino acids SIIPDVLEEDEDDPESEPEGQDIDELYHFVKQTHQQETQSIQVDVQHPALGATA4 antibody
The GATA4 antibody is a highly specialized monoclonal antibody that exhibits neutralizing properties. This antibody is widely used in Life Sciences research to study various cellular processes and signaling pathways. It specifically targets GATA4, a transcription factor that plays a crucial role in the regulation of gene expression. By binding to GATA4, this antibody effectively inhibits its activity and prevents it from activating downstream target genes.TKTL2 antibody
TKTL2 antibody was raised using the C terminal of TKTL2 corresponding to a region with amino acids SSAKATGGRVITVEDHYREGGIGEAVCAAVSREPDILVHQLAVSGVPQRGGBP4 antibody
GBP4 antibody was raised using the middle region of GBP4 corresponding to a region with amino acids NAVTALAQLENPAAVQRAADHYSQQMAQQLRLPTDTLQELLDVHAACERECXADR antibody
The CXADR antibody is a highly specialized cell antigen that is commonly used in Life Sciences research. This antibody specifically targets the CXADR protein, which plays a crucial role in various cellular processes. The CXADR antibody has been extensively studied and characterized for its glycosylation patterns, particularly the presence of alpha-gal epitopes.EPHA10 antibody
The EPHA10 antibody is a highly specialized growth factor that plays a crucial role in various cellular processes. It acts by binding to the messenger RNA (mRNA) of specific target cells and influencing their lipid composition. The EPHA10 antibody has been extensively studied as a potential therapeutic agent for various diseases, including cancer.CCDC144B antibody
CCDC144B antibody was raised using the middle region of CCDC144B corresponding to a region with amino acids TELSGTLTDGTTVGNDDDGLNQQIPRKENEEHDRPADKTANEKNKVKNQIAXUD1 antibody
AXUD1 antibody was raised in rabbit using human AXUD1 protein as the immunogen.Purity:Min. 95%CLIC1 antibody
CLIC1 antibody was raised using the N terminal of CLIC1 corresponding to a region with amino acids GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFSRD5A1 antibody
The SRD5A1 antibody is a growth factor that plays a crucial role in the regulation of glucagon and epidermal growth. It is widely used in Life Sciences research as a tool to study various cellular processes. This polyclonal antibody specifically targets SRD5A1, an enzyme involved in the metabolism of hydrogen sulfate, and has been shown to have anti-mesothelin activity. The SRD5A1 antibody can be used for various applications such as immunohistochemistry, Western blotting, and ELISA. Additionally, it can be used as a neutralizing agent in experiments involving monoclonal antibodies targeting epidermal growth factor or vitronectin. Researchers can rely on the high quality and specificity of this antibody to obtain accurate and reliable results in their studies.NIT1 antibody
NIT1 antibody was raised using the N terminal of NIT1 corresponding to a region with amino acids VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLARECp70S6K antibody
The p70S6K antibody is a growth factor that plays a crucial role in cell proliferation and survival. It is commonly used in Life Sciences research as a tool to study various cellular processes. This antibody specifically targets the p70S6K protein, which is involved in the regulation of protein synthesis and cell growth. By inhibiting the activity of p70S6K, this antibody can provide valuable insights into the signaling pathways that control cell division and differentiation.ADK antibody
The ADK antibody is a monoclonal antibody that has cytotoxic properties. It specifically targets collagen and hepatocyte growth factor (HGF) protein, inhibiting their activity. This antibody has been shown to be effective at low pH levels and can neutralize the effects of angptl3, a growth factor involved in various biological processes. The ADK antibody is widely used in the field of Life Sciences for research purposes, as it can selectively bind to activated glycoproteins and reactive molecules. Its chromatographic properties make it suitable for purification and analysis applications.TEK antibody
The TEK antibody is a highly specialized monoclonal antibody that targets the activated cholinergic receptor. This antibody has been extensively tested and proven to have neutralizing effects on the target molecule. It is commonly used in Life Sciences research for its ability to inhibit carbonic activity and effectively block the action of specific virus surface antigens. Additionally, this monoclonal antibody has shown promising results in inhibiting fibrinogen activity, making it a potential candidate for use as an anticoagulant. The TEK antibody has been developed using advanced mass spectrometric methods, ensuring its high quality and specificity. With its wide range of applications and impressive efficacy, this monoclonal antibody is a valuable tool for researchers in various fields.
Phenobarbital antibody
Phenobarbital antibody was raised in mouse using phenobarbital-KLH as the immunogen.
Pig RBC antibody (Texas Red)
Pig RBC antibody (Texas Red) was raised in rabbit using porcine erythrocytes as the immunogen.KIF2C antibody
KIF2C antibody was raised in mouse using recombinant Human Kinesin Family Member 2C (Kif2C)Cyclin H antibody
The Cyclin H antibody is a highly specialized antibody used in Life Sciences research. It is designed to target and detect cyclin H, a protein involved in cell cycle regulation. This specific antibody is produced through advanced monoclonal antibody technology, ensuring high specificity and sensitivity in its detection.RAB39 antibody
RAB39 antibody was raised using the N terminal of RAB39 corresponding to a region with amino acids METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFFARID3C antibody
ARID3C antibody was raised in rabbit using the C terminal of ARID3C as the immunogenPurity:Min. 95%TDRD3 antibody
The TDRD3 antibody is a polyclonal antibody that specifically targets TDRD3 protein. It can be used in various research applications, including immunohistochemistry, western blotting, and immunofluorescence. TDRD3 is involved in the regulation of gene expression and plays a crucial role in spermatogenesis and embryonic development. This antibody has been shown to have neutralizing activity against dopamine and other growth factors, making it a valuable tool for studying their functions. Additionally, it can be used to detect the presence of TDRD3 autoantibodies in patient samples, which may have implications in certain diseases such as cancer or neurological disorders. With its high specificity and sensitivity, the TDRD3 antibody is an essential tool for researchers in the life sciences field.IGF1 antibody
The IGF1 antibody is a glycosylated monoclonal antibody that is used in the field of Life Sciences. It is designed to specifically bind to and neutralize interferon gamma (IFN-gamma), a cytokine involved in immune response regulation. This antibody has been extensively studied and has shown high affinity and specificity for IFN-gamma. It has been used in various research applications, including immunohistochemistry, flow cytometry, and Western blotting. The IGF1 antibody is formulated with excipients to ensure stability and efficacy. Its low density and acidic nature allow for easy penetration into tissues and cells. Additionally, this antibody has been conjugated with various labels such as fluorescent dyes or enzymes for detection purposes. Overall, the IGF1 antibody is a valuable tool for researchers studying the role of IFN-gamma in different biological processes.CLECL1 antibody
CLECL1 antibody was raised using the middle region of CLECL1 corresponding to a region with amino acids FSLFLICAMAGDVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAK
Caspase 6 antibody
The Caspase 6 antibody is a monoclonal antibody that specifically targets caspase 6, an enzyme involved in programmed cell death. This antibody binds to the nuclear region of cells and inhibits the activity of caspase 6, preventing cell death. It can be used as a therapeutic agent for conditions where excessive cell death is occurring.
OLIG2 antibody
The OLIG2 antibody is a highly specific monoclonal antibody that targets the OLIG2 protein. OLIG2 is a transcription factor that plays a critical role in the development of the central nervous system. This antibody binds to the antigen binding domain of OLIG2 and can be used for various applications in life sciences research.EPB41 antibody
EPB41 antibody was raised using the N terminal of EPB41 corresponding to a region with amino acids SESRGLSRLFSSFLKRPKSQVSEEEGKEVESDKEKGEGGQKEIEFGTSLDHTR2A antibody
The HTR2A antibody is a potent inhibitor that targets the HTR2A receptor, which is involved in various cellular processes. This antibody can be used for hybridization experiments to study the expression and localization of the HTR2A receptor in different tissues. Additionally, it has cytotoxic properties and can be utilized for therapeutic purposes to selectively kill cells expressing high levels of the HTR2A receptor. The HTR2A antibody is also commonly used in life sciences research to investigate the role of this receptor in signal transduction pathways, protein kinase activation, and endothelial growth factor regulation. Furthermore, it has anti-angiogenic properties and can inhibit the growth of blood vessels by targeting vascular endothelial growth factor (VEGF). The HTR2A antibody is available as a polyclonal antibody, ensuring high specificity and sensitivity for detecting the HTR2A receptor in various experimental settings.MED8 antibody
MED8 antibody was raised using the N terminal of MED8 corresponding to a region with amino acids MQREEKQLEASLDALLSQVADLKNSLGSFICKLENEYGRLTWPSVLDSFAp27Kip1 antibody
The p27Kip1 antibody is a highly specialized biomolecule that plays a crucial role in cell cycle regulation. It acts as a phosphatase inhibitor and interacts with various growth factors, including TNF-α, to control cell proliferation. This monoclonal antibody has the unique ability to neutralize the effects of chemokines, preventing them from promoting inflammation and immune responses. Additionally, it has been used in ophthalmic formulations to target specific conditions such as diabetic retinopathy.
CPEB2 antibody
CPEB2 antibody was raised using the middle region of CPEB2 corresponding to a region with amino acids DTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLHelicase antibody
Helicase antibody was raised using a synthetic peptide corresponding to a region with amino acids FGRFPITGAWWRVKVQVKPVVGSRSYQYQVQGFPSYFLQSDMSPPNQKHITNRC6B antibody
TNRC6B antibody was raised using the N terminal of TNRC6B corresponding to a region with amino acids LQSESGTAPVWSKSTPPAPDNGTSAWGEPNESSPGWGEMDDTGASTTGWG
FYN antibody
FYN antibody was raised using the middle region of FYN corresponding to a region with amino acids CPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENPurity:Min. 95%SCP2 antibody
SCP2 antibody was raised using the middle region of SCP2 corresponding to a region with amino acids NHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILAApoBEC3F antibody
ApoBEC3F antibody was raised using the middle region of APOBEC3F corresponding to a region with amino acids MYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVYSQVASP antibody
The VASP antibody is an inhibitory factor that targets various growth factors in the body. This monoclonal antibody specifically binds to histidine residues and has been extensively tested for its effectiveness. It is commonly used in research laboratories and medical facilities for experiments involving growth factors, such as hepatocyte growth factor, epidermal growth factor, c-myc, and leukemia inhibitory factor.NTHL1 antibody
NTHL1 antibody was raised in mouse using recombinant Human Nth Endonuclease Iii-Like 1 (E. Coli) (Nthl1)Cytokeratin 18 antibody
The Cytokeratin 18 antibody is a highly specialized monoclonal antibody that targets the protein Cytokeratin 18. Cytokeratin 18 is a tyrosine kinase-like phosphatase that plays a crucial role in maintaining the structure and function of actin filaments. This antibody is widely used in life sciences research, particularly in studies related to growth factors, actin dynamics, collagen synthesis, and cellular signaling pathways.GPR161 antibody
GPR161 antibody was raised using the C terminal of GPR161 corresponding to a region with amino acids INLFGEEALPGVLVTARTVPGGGFGGRRGSRTLVSQRLQLQSIEEGDVLACOPG antibody
COPG antibody was raised using the N terminal of COPG corresponding to a region with amino acids MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTK
p38 antibody
The p38 antibody is a highly specialized product used in Life Sciences research. It is an antibody that specifically targets the p38 mitogen-activated protein kinase (MAPK). This antibody is widely used as a tool to study the function and regulation of p38 MAPK in various cellular processes.Purity:Min. 95%DARPP32 antibody
The DARPP32 antibody is a potent family kinase inhibitor that is widely used in the Life Sciences field. It targets alpha-fetoprotein, TGF-beta, growth factors, and androgen receptors to regulate various cellular processes. This antibody has also been shown to interact with collagen, annexin, and other proteins involved in cell signaling pathways. With both polyclonal and monoclonal options available, researchers can choose the most suitable antibody for their specific experiments. Whether you're studying Helicobacter infection or investigating protein interactions, the DARPP32 antibody is an essential tool for your research needs.FOXO1 antibody
The FOXO1 antibody is a glycoprotein that acts as an anti-ganglioside and cytotoxic agent. It specifically targets TGF-beta1, a protein involved in cell growth and differentiation. The monoclonal antibody has been shown to neutralize the effects of TGF-beta1 on human hepatocytes, preventing reactive responses and promoting normal cellular function. Additionally, the FOXO1 antibody has natriuretic and carbonic properties, contributing to its therapeutic potential in various conditions related to fluid balance and acid-base regulation. This product is part of our extensive collection of Polyclonal Antibodies, specifically designed for use in Life Sciences research. Trust our high-quality monoclonal antibodies to provide accurate and reliable results for your experiments.TTK antibody
TTK antibody is a polyclonal antibody that specifically targets the TTK protein kinase. This protein plays a crucial role in cell division and has been implicated in various diseases, including cancer. The TTK antibody can be used in research settings to study the function of this protein and its potential as a therapeutic target. It is also useful for detecting TTK expression levels in different tissues and cell types. The TTK antibody is highly specific and has been validated for use in various applications, including Western blotting, immunohistochemistry, and flow cytometry. With its exceptional sensitivity and reliability, the TTK antibody is an essential tool for scientists working in the field of life sciences.Benzoylecgonine antibody
Benzoylecgonine antibody was raised in mouse using benzoylecgonine-BSA as the immunogen.CD42c antibody
The CD42c antibody is a growth factor protein that is widely used in the field of Life Sciences. It plays a crucial role in various cellular processes, including glucose-6-phosphate metabolism and collagen synthesis. This antibody is commonly used in research to study the activation of platelets and their interaction with other cells and molecules.
M6PR antibody
M6PR antibody was raised using a synthetic peptide corresponding to a region with amino acids RLKPLFNKSFESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKEPGAM2 antibody
PGAM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDT
PFKL antibody
The PFKL antibody is a monoclonal antibody that targets amyloid protein and has various characteristics and applications. It has been shown to inhibit the production of chemokines and TNF-α, which are involved in inflammatory responses. Additionally, the PFKL antibody has been used in studies related to Brucella abortus infection, adipose tissue regulation, adeno-associated viruses, and calmodulin signaling.SLPI antibody
The SLPI antibody is a polyclonal antibody that specifically targets SLPI (Secretory Leukocyte Protease Inhibitor), a protein found in human serum and various tissues. This antibody is widely used in life sciences research and diagnostics. It can be used for various applications, including immunohistochemistry, Western blotting, ELISA, and flow cytometry.hnRNP K antibody
The hnRNP K antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets hnRNP K, a protein involved in various cellular processes including RNA metabolism and transcriptional regulation. This antibody can be used to study the role of hnRNP K in different biological pathways and its interactions with other proteins such as epidermal growth factor and synaptic proteins. Additionally, the hnRNP K antibody has been shown to have neutralizing properties against certain growth factors like hepatocyte growth factor. It is highly specific and does not cross-react with other proteins or undergo denaturation when exposed to benzalkonium chloride or n-ethylmaleimide-sensitive factor. With its ability to detect different isoforms of hnRNP K, this antibody is a valuable tool for researchers studying gene expression and protein function.CDKL3 antibody
CDKL3 antibody was raised in rabbit using residues 14-29 [SYGTVMKCKHKNTGQI] of the 50 kDa human NKIAMRE protein as the immunogen.Purity:Min. 95%CASP8AP2 antibody
CASP8AP2 antibody was raised in rabbit using the N terminal of CASP8AP2 as the immunogenPurity:Min. 95%AK3 antibody
The AK3 antibody is a monoclonal antibody that specifically targets the growth factor AK3. It has been widely used in research and diagnostics to detect the presence of AK3 in various biological samples. The AK3 antibody emits a strong signal when bound to its target, making it highly sensitive and reliable for detecting AK3 levels. Additionally, this monoclonal antibody has been shown to have high affinity and specificity for AK3, ensuring accurate and precise results. Whether you're studying angiogenesis, tumor development, or any other life science-related field, the AK3 antibody is an essential tool for your research. With its ability to accurately measure microvessel density and detect alpha-synuclein in blood plasma, this monoclonal antibody opens up new avenues for understanding disease mechanisms and developing targeted therapies. Trust the power of magnetic particles conjugated with the AK3 monoclonal antibodies for your next experiment or diagnostic assay.CFTR antibody
CFTR antibody was raised in mouse using a synthetic peptide(RKGYRQRLELSD) corresponding to residues 25-36 of human cystic fibrosis transmembrane conductance regulator (CFTR) as the immunogen.PFAS antibody
PFAS antibody was raised using a synthetic peptide corresponding to a region with amino acids ESIMSTQESSNPNNVLKFCDNSSAIQGKEVRFLRPEDPTRPSRFQQQQGLCYB5D1 antibody
CYB5D1 antibody was raised using the middle region of CYB5D1 corresponding to a region with amino acids KYEGKNLNMDFTLEENGIRDEEEEFDYLSMDGTLHTPAILLYFNDDLTELWIPI1 antibody
WIPI1 antibody was raised using the N terminal of WIPI1 corresponding to a region with amino acids AGYKLFSLSSVEQLDQVHGSNEIPDVYIVERLFSSSLVVVVSHTKPRQMN
RRAGC antibody
RRAGC antibody was raised in mouse using recombinant Human Ras-Related Gtp Binding C (Rragc)HSP27 antibody
The HSP27 antibody is a highly specific monoclonal antibody that targets the HSP27 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and shown to be effective in detecting HSP27 in different biological samples, including human serum and tissue sections.Laminin Beta 3 antibody
Laminin Beta 3 antibody was raised using the middle region of LAMB3 corresponding to a region with amino acids ERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKDPurity:Min. 95%SHROOM2 antibody
SHROOM2 antibody was raised using the middle region of SHROOM2 corresponding to a region with amino acids CTSPPGLSYMKAKEKTVEDLKSEELAREIVGKDKSLADILDPSVKIKTTMCD62E antibody
The CD62E antibody is a highly specialized monoclonal antibody that is used in various Life Sciences assays. It specifically targets and binds to the CD62E molecule, also known as E-selectin, which is a cell adhesion molecule involved in inflammation and immune responses. This antibody is buffered and formulated with collagen-coated microparticles for enhanced stability and performance. The CD62E antibody can be used in combination with other antibodies or reagents to study the expression and function of CD62E in different biological samples, including human serum. Its high specificity and sensitivity make it an essential tool for researchers studying various aspects of cell adhesion, inflammation, and immune system regulation.CTDSPL antibody
CTDSPL antibody was raised using a synthetic peptide corresponding to a region with amino acids CCFRDYNVEAPPPSSPSVLPPLVEENGGLQKPPAKYLLPEVTVLDYGKKC
AK3 antibody
The AK3 antibody is a highly specialized biomolecule that falls under the category of antibodies in the field of Life Sciences. It possesses unique properties that make it an essential tool for various applications. This monoclonal antibody has been proven to exhibit neutralizing effects against interferons, which are crucial in immune responses and antiviral defense mechanisms.ACSS2 antibody
The ACSS2 antibody is a monoclonal antibody that is used in the field of Life Sciences for various applications. It has been specifically designed to target and bind to ACSS2, an enzyme involved in cellular metabolism. This antibody can be used in research studies to investigate the role of ACSS2 in different biological processes.ZNF177 antibody
ZNF177 antibody was raised in rabbit using the N terminal of ZNF177 as the immunogen
Purity:Min. 95%GKN1 antibody
The GKN1 antibody is a highly specialized monoclonal antibody that targets the nuclear antigen found in adipose tissues. It is specifically designed to detect and bind to GKN1, a protein produced by adipocytes. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting GKN1 in various samples, including human serum.NT5DC2 antibody
NT5DC2 antibody was raised using the N terminal of NT5DC2 corresponding to a region with amino acids IRKYDYNPSFAIRGLHYDIQKSLLMKIDAFHYVQLGTAYRGLQPVPDEEVLONRF3 antibody
LONRF3 antibody was raised using the N terminal of LONRF3 corresponding to a region with amino acids QPPPPLRVNVVLSGLLGKLFPGPARASQLRHEGNRLYRERQVEAALLKYNDDX5 antibody
DDX5 antibody was raised in mouse using recombinant Human Dead (Asp-Glu-Ala-Asp) Box Polypeptide 5 (Ddx5)
C1ORF102 antibody
C1ORF102 antibody was raised using the N terminal Of C1Orf102 corresponding to a region with amino acids MSVRTLPLLFLNLGGEMLYILDQRLRAQNIPGDKARKDEWTEVDRKRVLNInsulin+Proinsulin antibody
Insulin/proinsulin antibody was raised in mouse using purified mouse insulin and proinsulin as the immunogen.Purity:>92% By Gel Electrophoresis And Gel ScanningCD52 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, thus inhibiting bacterial growth and preventing transcription and replication. Extensive research has been conducted on human erythrocytes using a patch-clamp technique, demonstrating its high frequency of human activity. In terms of metabolism, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.Telomerase antibody
Telomerase antibody is a monoclonal antibody that specifically targets the telomerase enzyme. Telomerase plays a crucial role in maintaining the length of telomeres, which are protective caps at the ends of chromosomes. This antibody binds to the catalytic subunit of telomerase and inhibits its activity, leading to telomere shortening and eventual cell death.GCN5L2 antibody
GCN5L2 antibody was raised in mouse using recombinant human GCN5L2 (411-837aa) purified from E. coli as the immunogen.SUPT4H1 antibody
SUPT4H1 antibody was raised in mouse using recombinant Human Suppressor Of Ty 4 Homolog 1 (S. Cerevisiae) (Supt4H1)Bcl-2 antibody
Bcl-2 antibody was raised in mouse using recombinant human Bcl-2 (1-211aa) purified from E. coli as the immunogen.ADNP antibody
ADNP antibody was raised in mouse using recombinant Human Activity-Dependent Neuroprotector HomeoboxARID4A antibody
ARID4A antibody was raised in mouse using recombinant Human At Rich Interactive Domain 4A (Rbp1-Like) (Arid4A)Human Serum amyloid A monoclonal antibody
The Human Serum amyloid A monoclonal antibody is a powerful therapeutic agent with antioxidant activity. This monoclonal antibody specifically targets human serum and has been extensively studied in the field of Life Sciences. It exhibits strong inhibitory effects on protein kinase, which plays a crucial role in various cellular processes. The Human Serum amyloid A monoclonal antibody is designed using advanced techniques such as DNA aptamers and cyclic peptides, ensuring high specificity and efficacy. Through molecular docking studies, its pharmacodynamics properties have been thoroughly investigated, making it an ideal candidate for targeted therapy. Additionally, this antibody has shown promising results in inhibiting the growth factor signaling pathways associated with certain diseases. With its industrial applications and potential use in research and clinical settings, the Human Serum amyloid A monoclonal antibody represents a significant advancement in the field of Antibodies.ATM antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a highly effective antituberculosis drug that falls under the class of rifamycins. It is known for its potent bactericidal activity against tuberculosis infection. By binding to DNA-dependent RNA polymerase, this active compound inhibits bacterial growth by preventing transcription and replication. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting cell growth in culture. The metabolization process involves various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid.BNIP1 antibody
BNIP1 antibody was raised in rabbit using the N terminal of BNIP1 as the immunogenPurity:Min. 95%
