Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75562 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
FSTL5 antibody
FSTL5 antibody was raised using the middle region of FSTL5 corresponding to a region with amino acids EAFDIYTNLHISDLAFQPSFTEAHQYNIYGSSSTQTDVLFVELSSGKVKMMAS1 antibody
MAS1 antibody was raised using the middle region of MAS1 corresponding to a region with amino acids RPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAIKEAP1 antibody
The KEAP1 antibody is a highly specialized monoclonal antibody that belongs to the category of Life Sciences products. It is specifically designed to target and bind to KEAP1, a protein involved in cellular response to oxidative stress. This antibody has been extensively studied and has shown promising results in various research fields.CPN60 antibody
The CPN60 antibody is a highly specialized monoclonal antibody that targets CPN60, a protein involved in various biological processes. It has been extensively studied for its role in interferon signaling and its ability to bind to autoantibodies. This antibody has also shown promising results in inhibiting lipoprotein lipase glycosylation, which is important for lipid metabolism. Furthermore, it has been found to regulate fibroin production and promote fas-mediated apoptosis. The CPN60 antibody is widely used in life sciences research and has become an essential tool for studying protein interactions and cellular processes. Whether you need polyclonal or monoclonal antibodies, the CPN60 antibody is a valuable addition to your laboratory toolkit.Prolactin antibody
Prolactin antibody is a highly versatile and potent antibody that has various applications in the field of life sciences. It exhibits antiviral and anticoagulant properties, making it an essential tool for research in these areas. Additionally, this antibody can bind to antiphospholipid antibodies, which are associated with autoimmune disorders such as lupus and antiphospholipid syndrome.HNF4G antibody
HNF4G antibody was raised using the N terminal of HNF4G corresponding to a region with amino acids MDMANYSEVLDPTYTTLEFETMQILYNSSDSSAPETSMNTTDNGVNCLCANewcastle disease virus antibody
The Newcastle disease virus antibody is a highly effective monoclonal antibody that is used in the field of Life Sciences. This recombinant virus antibody specifically targets the Newcastle disease virus, a type 2 cytokine that causes respiratory and neurological disorders in birds. The antibody works by binding to specific markers on the virus, preventing its replication and spread within the host. Additionally, this antibody has been shown to have probiotic effects by promoting the growth of beneficial bacteria in the gut. It can be used for various applications such as enzyme labeling, diagnostic assays, and research purposes. With its high specificity and superoxide dismutase activity, this monoclonal antibody is an essential tool for scientists and researchers working in the field of virology.PROM2 antibody
The PROM2 antibody is a highly activated Monoclonal Antibody that is widely used in the Life Sciences field. It specifically targets the PROM2 protein, which plays a crucial role in various cellular processes. This antibody has been shown to have neutralizing and cytotoxic effects on cells expressing PROM2, making it an effective tool for studying its function.
alpha 1 Antichymotrypsin antibody
Alpha-1 antichymotrypsin antibody was raised in mouse using affinity purified alpha-1 antichymotrypsin as the immunogen.PITPNB antibody
PITPNB antibody was raised using the middle region of PITPNB corresponding to a region with amino acids ADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAYCytokeratin 14 antibody
The Cytokeratin 14 antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that specifically targets Cytokeratin 14, a protein found in human serum. This antibody is commonly used in research and diagnostic applications to detect the presence of Cytokeratin 14 in various samples.SRC antibody
SRC antibody was raised in Mouse using a purified recombinant fragment of SRC(aa10-193) expressed in E. coli as the immunogen.VTA1 antibody
VTA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYT
ACO1 antibody
ACO1 antibody was raised using the N terminal of ACO1 corresponding to a region with amino acids MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNCGRK6 antibody
The GRK6 antibody is a highly specialized protein that plays a crucial role in regulating cellular processes. It specifically targets alpha-synuclein, a protein associated with neurodegenerative disorders such as Parkinson's disease. By binding to alpha-synuclein, the GRK6 antibody prevents its aggregation and cytotoxic effects, ultimately promoting cell survival.PDIA4 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known to be the most effective among the rifamycins in treating tuberculosis infections. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through extensive testing using a patch-clamp technique on human erythrocytes.BCAS2 antibody
BCAS2 antibody was raised using the middle region of BCAS2 corresponding to a region with amino acids SKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
PCSK9 antibody
The PCSK9 antibody is a growth factor protein that acts as an inhibitory factor for epidermal growth factor (EGF) and hepatocyte growth factor (HGF). It is a monoclonal antibody that specifically targets and neutralizes PCSK9, a protein involved in the regulation of cholesterol metabolism. By blocking PCSK9, this antibody helps to lower LDL cholesterol levels in the blood, reducing the risk of cardiovascular diseases. The PCSK9 antibody can be used in various research applications such as enzyme-linked immunosorbent assay (ELISA), Western blotting, immunohistochemistry (IHC), and flow cytometry. With its high specificity and affinity, this antibody provides accurate and reliable results for cholesterol-related studies.
14-3-3 antibody
The 14-3-3 antibody is a highly specialized antibody used in the field of Life Sciences. It is commonly used in research and diagnostic applications to study various cellular processes. This antibody specifically targets the 14-3-3 isoforms, a group of proteins involved in signal transduction, cell cycle regulation, and apoptosis.
STS antibody
STS antibody was raised using a synthetic peptide corresponding to a region with amino acids LLFDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQTLPEVPDQFSWCRTC2 antibody
The CRTC2 antibody is a highly specialized antibody that targets the phosphatase activity of CRTC2, a protein kinase involved in various cellular processes. This antibody has antiviral properties and can neutralize the effects of TGF-beta, a key signaling molecule involved in cell growth and differentiation. It is available in both polyclonal and monoclonal forms, allowing for flexibility in experimental design. The CRTC2 antibody has been extensively studied in the field of life sciences and has shown promising results in the activation of mesenchymal stem cells and modulation of P2X receptors. Additionally, this antibody has been found to have synergistic effects when combined with red ginseng, further enhancing its therapeutic potential.
Keratin Type II antibody
Keratin Type II antibody was raised in mouse using human epidermal keratin as the immunogen.PCDHA4 antibody
PCDHA4 antibody was raised using the C terminal of PCDHA4 corresponding to a region with amino acids SGYNAWLSYELQPETASASIPFRVGLYTGEISTTRALDETDAPRQRLLVLPurity:Min. 95%Chl2 antibody
The Chl2 antibody is a neuroprotective agent commonly used in Life Sciences research. It is an antibody that specifically targets and neutralizes connexin, a glycoprotein involved in cell communication. The Chl2 antibody has been extensively studied for its ability to prevent denaturation of estrogen receptors, which are crucial for the regulation of steroid hormones. This monoclonal antibody has shown great promise in various biochemical and recombination studies, making it a valuable tool for researchers in the field. Its high specificity and affinity for connexin make it an ideal choice for experiments involving glycopeptides and hormone peptides.C21ORF45 antibody
C21ORF45 antibody was raised using the N terminal Of C21Orf45 corresponding to a region with amino acids MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWASYBX1 antibody
The YBX1 antibody is a highly specific monoclonal antibody that has been developed for ultrasensitive detection of human serum. It is designed to target Y-box binding protein 1 (YBX1), which plays a crucial role in various cellular processes such as transcription, translation, and DNA repair. The antibody has been extensively tested and validated using molecular docking techniques to ensure its high affinity and specificity towards YBX1.
AP1B1 antibody
AP1B1 antibody was raised in rabbit using the C terminal of AP1B1 as the immunogenPurity:Min. 95%SNAI1 antibody
The SNAI1 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to SNAI1, a protein involved in various cellular processes such as cell migration and epithelial-mesenchymal transition (EMT). This antibody has been extensively tested and proven to have inhibitory properties against SNAI1.M13/fd/F1 Filamentous Phages antibody (Biotin)
M13/fd/F1 Filamentous Phages antibody (Biotin) was raised in mouse using fd phages from E. coli F+ strain (JM109) as the immunogen.PDE10A antibody
The PDE10A antibody is a highly effective growth factor that targets actin filaments in the human body. This monoclonal antibody has been extensively tested and proven to be highly specific in its binding to actin, making it an ideal choice for research and diagnostic applications. It has also shown promising results in studies involving echinococcus and other parasites, indicating its potential as a therapeutic agent. The PDE10A antibody is available in both colloidal and nuclear forms, allowing for versatile use in various experimental settings. With its high affinity and specificity, this antibody is a valuable tool for researchers studying actin dynamics and related processes.NFKBIB antibody
NFKBIB antibody was raised in Mouse using a purified recombinant fragment of human NFKBIB expressed in E. coli as the immunogen.EPO antibody
EPO antibody was raised using the middle region of EPO corresponding to a region with amino acids KEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDPurity:Min. 95%HOXD10 antibody
The HOXD10 antibody is a highly reactive monoclonal antibody that is widely used in Life Sciences research. It has been specifically designed to neutralize the activity of fibrinogen, a key protein involved in blood clotting. This antibody offers ultrasensitive detection capabilities and can be used for various applications such as immunoassays and Western blotting.hCG beta antibody
hCG beta antibody was raised in mouse using human chorionic gonadotropin beta as the immunogen.C10ORF96 antibody
C10ORF96 antibody was raised using the middle region of C10Orf96 corresponding to a region with amino acids QRKLKVFEDEENESICTTKYLEAEKIKISEKPQNDTECLRLKKELELYKENCRNA00114 antibody
NCRNA00114 antibody was raised using the N terminal Of Ncrna00114 corresponding to a region with amino acids SFSKMRTGWRGAIPLRWRNRARNREKPHSPRAVSSPATHSLPPSNPCRLTPSMA4 antibody
The PSMA4 antibody is a highly specific monoclonal antibody that targets the proteasome subunit alpha type-4 (PSMA4). PSMA4 plays a crucial role in protein degradation and is involved in various cellular processes. This antibody recognizes specific epitopes on PSMA4 and can be used for research purposes, such as Western blotting, immunoprecipitation, and immunofluorescence.TRPC4 antibody
The TRPC4 antibody is a monoclonal antibody that specifically targets and binds to the TRPC4 protein. This protein plays a crucial role in various cellular processes, including calcium signaling and ion channel regulation. By binding to TRPC4, this antibody can modulate its activity and function.JAK2 antibody
The JAK2 antibody is a highly specific and reliable tool used in Life Sciences research. It is an antigen that targets autoantibodies and can be used for various applications. This antibody, whether polyclonal or monoclonal, binds to the nuclear protein JAK2, allowing for the detection and analysis of JAK2 expression in cells and tissues.FOXO3A antibody
The FOXO3A antibody is a high-quality polyclonal antibody used in Life Sciences. It specifically targets the mineralocorticoid receptor and has antiviral properties. This antibody is produced using excipients and globulin, ensuring its purity and effectiveness. It acts as an antigen, binding to specific proteins and neutralizing their activity. The FOXO3A antibody can be used as a medicament in various applications, including research and diagnostics. Its low density allows for easy handling and accurate dosing. Additionally, this antibody has been shown to inhibit the growth of certain factors that promote cell proliferation, making it a valuable tool in studying cellular processes. Autoantibodies against FOXO3A have also been identified, highlighting its significance in immune responses. Choose the FOXO3A antibody for reliable results and precise targeting of protein complexes.ACTA1 antibody
The ACTA1 antibody is a highly specialized monoclonal antibody that targets the ACTA1 protein. This protein is involved in muscle contraction and is essential for proper muscle function. The antibody specifically binds to the ACTA1 protein, preventing its interaction with other molecules and inhibiting muscle contraction.IKBKE antibody
IKBKE antibody was raised in Mouse using a purified recombinant fragment of IKBKE(aa1-257) expressed in E. coli as the immunogen.
PAK3 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication processes, thereby preventing bacterial growth. Its effectiveness has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, this drug specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.KLF4 antibody
KLF4 antibody was raised in Mouse using a purified recombinant fragment of human KLF4 expressed in E. coli as the immunogen.SF3B1 antibody
SF3B1 antibody was raised using the N terminal of SF3B1 corresponding to a region with amino acids ERLDPFADGGKTPDPKMNARTYMDVMREQHLTKEEREIRQQLAEKAKAGEMRP3 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for its growth. This drug exhibits bactericidal activity, effectively eliminating the bacteria causing the infection. Its mechanism of action involves binding to DNA-dependent RNA polymerase, which hinders transcription and replication processes necessary for bacterial survival. The efficacy of this drug has been demonstrated through rigorous testing using advanced techniques such as patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations in the body, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, 6-Fluoro-3-indoxyl-beta-D-galactopyranosAKT antibody
Akt, also known as Protein Kinase B (PKB), is a key enzyme involved in regulating cell growth, survival, metabolism, and proliferation within the PI3K/Akt/mTOR pathway, which responds to signals like growth factors. Upon activation through specific phosphorylation events, Akt drives essential cellular functions, including promoting cell survival, stimulating protein synthesis via mTOR, regulating glucose uptake, and facilitating blood vessel formation and cell movement. Due to its frequent hyperactivation in cancers, Akt is a significant target in cancer therapies, and its role in glucose metabolism links it to conditions like insulin resistance and type 2 diabetes.Goat anti Mouse IgM (HRP)
Goat anti-mouse IgM (HRP) was raised in goat using murine IgM mu chain as the immunogen.Purity:By ImmunoelectrophoresisCHIC1 antibody
CHIC1 antibody was raised using the N terminal of CHIC1 corresponding to a region with amino acids LRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLTGKVAPEEFKTSIGRVCD153 antibody
The CD153 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets CD153, a protein expressed on pluripotent stem cells. This antibody can be used in various research assays and experiments to study the function and behavior of pluripotent stem cells.EXOSC10 antibody
EXOSC10 antibody was raised using the C terminal of EXOSC10 corresponding to a region with amino acids FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRGS100 antibody
The S100 antibody is a highly specialized protein that plays a crucial role in various biological processes. It acts as a phosphatase and interacts with other proteins such as erythropoietin, interleukin-6, actin, collagen, fibrinogen, and β-catenin. This antibody is widely used in the field of Life Sciences for research purposes.STAT3 antibody
STAT3 antibody was raised in Mouse using a purified recombinant fragment of STAT3 expressed in E. coli as the immunogen.Human IgG antibody
The Human IgG antibody is a powerful inhibitory factor that targets various proteins and factors in the body. It has been shown to inhibit the activity of GM-CSF (colony-stimulating factor) and other cytokines involved in immune response regulation. This Monoclonal Antibody specifically binds to alpha-fetoprotein, autoantibodies, and antiphospholipid antibodies, neutralizing their effects. Additionally, it has been found to have a significant impact on interferon signaling pathways.CDCA2 antibody
The CDCA2 antibody is a highly effective protein kinase inhibitor that belongs to the family of kinase inhibitors. It is used in the field of Life Sciences as a valuable tool for studying various cellular processes. The CDCA2 antibody specifically targets TGF-beta, which is a key signaling molecule involved in cell growth and differentiation. This antibody can be used in both polyclonal and monoclonal forms, allowing for flexibility in experimental design. In addition to its use as a research tool, the CDCA2 antibody has also shown potential therapeutic applications, particularly in the field of regenerative medicine. It has been found to enhance the differentiation potential of mesenchymal stem cells and promote tissue regeneration. With its ability to inhibit specific kinases and modulate important cellular pathways, the CDCA2 antibody is an indispensable tool for researchers in various fields of study.Netrin 1 antibody
The Netrin 1 antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to Netrin 1, a protein involved in various cellular processes. It has been extensively tested and validated for its high specificity and affinity towards Netrin 1.MED31 antibody
MED31 antibody was raised using the N terminal of MED31 corresponding to a region with amino acids MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNRALY antibody
RALY antibody was raised using the middle region of RALY corresponding to a region with amino acids KIKLKSSELQAIKTELTQIKSNIDALLSRLEQIAAEQKANPDGKKKGDGGGCP3 antibody
The GCP3 antibody is a highly specialized diagnostic reagent used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and exhibits strong antigen-antibody reaction capabilities. This antibody is particularly effective in quantitating growth factors and neutralizing reactive substances in adipose tissues. With its unique properties, the GCP3 antibody can be used as a powerful tool for researchers and clinicians alike.Apelin antibody
The Apelin antibody is a multidrug that belongs to the class of Polyclonal Antibodies. It targets apelin, which is a growth factor involved in various physiological processes. The antibody can be used for research purposes in the field of Life Sciences, particularly in studies related to lipase activity, adipose tissue function, and cell signaling pathways. It has been shown to have potential therapeutic applications in the treatment of conditions such as obesity and cardiovascular diseases. The Apelin antibody is available in both monoclonal and polyclonal forms, allowing researchers to choose the most suitable option based on their specific experimental needs. With its ability to detect and bind to apelin with high specificity and sensitivity, this antibody is an invaluable tool for studying the role of apelin in various biological processes.IKB α antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. Known for its bactericidal activity, this drug effectively treats tuberculosis infections. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. The efficacy of this drug has been demonstrated through various scientific techniques such as patch-clamp technique on human erythrocytes. Metabolized through different metabolic transformations, including hydrolysis and oxidation, this drug specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture.CD5 antibody (Spectral Red)
CD5 antibody (Spectral Red) was raised in rat using CD5/Lyt-1 as the immunogen.ApoBEC2 antibody
ApoBEC2 antibody was raised using the middle region of APOBEC2 corresponding to a region with amino acids CKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADILSF1 antibody
SF1 antibody was raised using the C terminal of SF1 corresponding to a region with amino acids APPPPPPPPPGSAGMMIPPRGGDGPSHESEDFPRPLVTLPGRQPQQRPWWHNF4 alpha antibody
The HNF4 alpha antibody is a highly effective reagent used in the field of Life Sciences. It has the ability to inhibit the function of hematopoietic and pluripotent stem cells, making it a valuable tool for research and therapeutic applications. This antibody can be used in immunohistochemical studies to detect the presence of HNF4 alpha protein in various tissues and cell types. It is a polyclonal antibody, meaning it recognizes multiple epitopes on the target protein, resulting in high specificity and sensitivity. With its ability to accurately detect HNF4 alpha, researchers can gain valuable insights into the role of this protein in cellular processes and disease mechanisms. Whether you are studying cytokines or pluripotent stem cells, this HNF4 alpha antibody is an essential tool for your research needs.GLS2 antibody
GLS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFHDAC5 antibody
The HDAC5 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. This antibody specifically targets and binds to HDAC5, which stands for Histone Deacetylase 5. HDAC5 is an enzyme involved in the regulation of gene expression by modifying histones, which are proteins that help package DNA in cells. By binding to HDAC5, this antibody can modulate its activity and potentially impact various cellular processes.SOX17 antibody
The SOX17 antibody is a monoclonal antibody that specifically targets glucagon, a hormone involved in regulating blood sugar levels. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It can be used to detect and measure glucagon levels in human serum, making it a valuable tool for research and diagnostic purposes. Additionally, the SOX17 antibody has been found to have cytotoxic effects on certain cancer cells, making it a potential candidate for targeted therapy. Its high specificity and affinity for glucagon make it an ideal choice for experiments involving the detection and manipulation of this hormone. Whether you are studying the role of glucagon in diabetes or investigating its interaction with other molecules such as insulin or collagen, the SOX17 antibody is an indispensable tool that will provide reliable and accurate results.TFEB antibody
The TFEB antibody is a highly specialized product in the field of Life Sciences. It is designed to specifically bind to the TFEB receptor, which plays a crucial role in various cellular processes such as glucagon signaling and collagen synthesis. This antibody is widely used in research laboratories for studying the function and regulation of TFEB.Helicobacter pylori antibody
The Helicobacter pylori antibody is a monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the helicobacter bacteria, allowing for the detection and study of this pathogen. The antibody can be used in various applications, such as immunoassays and immunohistochemistry, to identify and quantify the presence of helicobacter in samples. Additionally, this antibody has been shown to have cytotoxic effects on helicobacter cells, making it a valuable tool for studying the mechanisms of bacterial infection and developing new therapeutic strategies. With its high specificity and affinity, the Helicobacter pylori antibody is an essential component in research related to infectious diseases and microbiology.CD18 antibody
CD18 antibody was raised in mouse using leucocytes from LGL-type leukemia as the immunogen.NFkB p65 antibody
The NFkB p65 antibody is a polyclonal antibody that is used for various applications in the field of Life Sciences. It is specifically designed to target and neutralize the NFkB p65 protein, which plays a crucial role in cellular signaling pathways. This antibody can be used for techniques such as hybridization, immunoprecipitation, and immunofluorescence.ALOX15B antibody
ALOX15B antibody was raised using the C terminal of ALOX15B corresponding to a region with amino acids ATCEGFIATLPPVNATCDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPRC2ORF29 antibody
C2ORF29 antibody was raised using the middle region of C2Orf29 corresponding to a region with amino acids SVDISGLQLALAERQSELPTQSKASFPSILSDPDPDSSNSGFDSSVASQIGPC5 antibody
The GPC5 antibody is a highly specialized Polyclonal Antibody that targets the lipoprotein lipase, an enzyme involved in lipid metabolism. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It specifically binds to GPC5, a growth factor that plays a crucial role in adipose tissue development and function.Rabbit anti Mouse IgG3 (HRP)
Rabbit anti-mouse IgG3 (HRP) was raised in rabbit using murine IgG3 heavy chain as the immunogen.RNF121 antibody
RNF121 antibody was raised using the N terminal of RNF121 corresponding to a region with amino acids WWRFLVIWILFSAVTAFVTFRATRKPLVQTTPRLVYKWFLLIYKISYATGCARS antibody
CARS antibody was raised using the C terminal of CARS corresponding to a region with amino acids KRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHD
PBEF1 antibody
PBEF1 antibody was raised using the C terminal of PBEF1 corresponding to a region with amino acids VTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEIRKNAQLNIELEAAHp53 antibody
The p53 antibody is a highly specific monoclonal antibody that is used in various research and diagnostic applications. It is designed to target and bind to the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. This antibody can be used for immunohistochemistry, Western blotting, flow cytometry, and other techniques to detect and analyze the expression of p53 in different samples.ICK antibody
The ICK antibody is a powerful tool in Life Sciences research. This polyclonal antibody specifically targets the protein ICK, which plays a crucial role in various cellular processes. By binding to ICK, this antibody can be used to study its function and regulation.Tau antibody
The Tau antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and neutralizes the activity of tau protein, which is involved in the formation of neurofibrillary tangles found in Alzheimer's disease and other neurodegenerative disorders. This antibody has been extensively studied and proven to effectively bind to tau protein, inhibiting its aggregation and promoting its clearance from brain cells.CCDC7 antibody
CCDC7 antibody was raised using the N terminal of CCDC7 corresponding to a region with amino acids KHNAKLIHDKIEPMVLRSPPTGESILRYALPIPSSKTKNLLPEDEMIGKIADAD2 antibody
ADAD2 antibody was raised using the C terminal of ADAD2 corresponding to a region with amino acids TPDTCRGLSLNWSLGDPGIEVVDVATGRVKANAALGPPSRLCKASFLRAFSynaptojanin 1 antibody
Synaptojanin 1 antibody was raised using the middle region of SYNJ1 corresponding to a region with amino acids PGVARREMEAPKSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPPLipase J antibody
Lipase J antibody was raised using the C terminal of LIPJ corresponding to a region with amino acids LNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHI
KLK1 antibody
The KLK1 antibody is a polyclonal antibody that is used in life sciences research. It is designed to target and neutralize the effects of acetylcholine, interferon, chemokine, and other molecules involved in intraocular endothelial growth. This antibody has been shown to be effective in blocking the activity of these molecules, thereby inhibiting their effects on cell growth and function. Additionally, the KLK1 antibody can be used to detect the presence of autoantibodies or test compounds in biological samples. Its high specificity and affinity make it an essential tool for researchers studying growth factors and their role in various physiological processes.
STAT1 antibody
The STAT1 antibody is a highly specialized monoclonal antibody that targets the signal transducer and activator of transcription 1 (STAT1) protein. This antibody is commonly used in life sciences research to study various cellular processes, including growth factor signaling, insulin regulation, and immune responses.
CD325 antibody
The CD325 antibody is a highly specialized monoclonal antibody that targets β-catenin, a protein involved in cell adhesion and signaling pathways. It is commonly used in life sciences research to study the role of β-catenin in various cellular processes. The CD325 antibody specifically recognizes the non-phosphorylated form of β-catenin, allowing for precise detection and analysis.SMUG1 antibody
The SMUG1 antibody is a highly specific and potent antibody that can be used in various applications in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, providing researchers with flexibility in their experimental design.
